(data stored in ACNUC16935 zone)

EMBL: BN001307.PE406

BN001307.PE406       Location/Qualifiers
FT   CDS_pept        join(1127406..1127610,1127697..1128130)
FT                   /locus_tag="ANIA_01561"
FT                   /old_locus_tag="AN1561.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008190"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008190"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008190"
FT                   /db_xref="GOA:Q5BD19"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD19"
FT                   /protein_id="CBF85113.1"
FT                   /translation="MIALALLAPLLAGQTIGSVSPSLKRDDSKSNAFTPGTTDGCPAGW
FT                   PTCGSSGICYNPDEGATCCPGGTYACPSSTFCLLDPYCCPDDLTPESCAKEYGLTLVPT
FT                   SPPSESTTFPPPKPSDSDSENDSGGHHRPTAHPTSSDSANSSITLSPTPIRTSSVVLWP
FT                   SLSVIPTGSPSAGQEPAYTGTGGSWRVRGGELATIAGAGALAIGVLCWV"
     atgattgctc tcgccctttt ggcccccctt ctggcgggcc agaccatcgg gtctgtttcg        60
     ccttcactca agcgagacga cagcaagagc aatgccttca ctccaggaac gaccgacggc       120
     tgcccagccg gctggcctac ctgcggctcc agcggcatct gctacaaccc agacgaagga       180
     gcaacctgtt gtccaggagg aacttatgcc tgcccctcct ccaccttctg cctgctagat       240
     ccctactgct gccccgacga cctcacgccc gaatcctgcg cgaaagaata tggcctcact       300
     cttgtcccga caagcccgcc gtccgagtca acgacatttc cgccacctaa accaagcgat       360
     agcgatagcg agaacgacag tggtggtcac caccgaccga ccgcgcaccc gacgtcatcg       420
     gattccgcga acagcagtat cacccttagt ccgacaccta tccggacaag ctcagttgtg       480
     ctgtggccga gtctgagtgt tatcccgacg gggagtccca gtgcgggaca ggagccggcc       540
     tatacaggga cgggcgggag ttggcgagtg agaggtggag agttggcgac tattgctggt       600
     gctggggctt tagccatagg ggtgctgtgc tgggtttga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page