(data stored in ACNUC16935 zone)

EMBL: BN001307.PE407

BN001307.PE407       Location/Qualifiers
FT   CDS_pept        complement(1129892..1130815)
FT                   /locus_tag="ANIA_01562"
FT                   /old_locus_tag="AN1562.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008191"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008191"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008191"
FT                   /db_xref="GOA:Q5BD18"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD18"
FT                   /protein_id="CBF85115.1"
FT                   /translation="MGQERPTGRSLARRLLLAALDREEQGYPPAHQSLYPTIGSINYDP
FT                   TVETPEPTDARARRFTINRTDASVLIPPSDKLLVFRALTGIDSTPALNLSHHTPRTAPN
FT                   IGIYTRVVRAETKAAKRYRFHAALINTCLGIQIVVAAALTALGAARGPHNAVTAFGAIN
FT                   TIVAGILTYLKGSGLPDRLKHYQNEWRNIREYIEQRERELCLEGCGLDVEEEIRIIEQM
FT                   YEGVKREIEATKSGGDNRSFSRDRTSTRRPVIQQTEQSREYAPRRSPSPARTSEAFEKH
FT                   YHEPRREFTPRPPSPARVHERFEKHY"
     atgggacaag agcgaccaac gggccgcagt cttgcaagac gcctcctact ggcggcactc        60
     gaccgtgaag agcagggcta tcctcctgca caccagtccc tctatccgac tattggaagc       120
     ataaattatg atcccaccgt cgagacccca gagcccaccg atgcaagggc gcgacgcttt       180
     acgatcaaca ggacagatgc tagcgtcctc atcccgccaa gtgacaagct cctcgtcttc       240
     cgcgctctca ctgggatcga cagtacgccg gcactaaatc tgtcacacca tactcctcga       300
     acagcgccta atattggcat ctacacgcgg gtcgtgaggg ccgaaactaa agccgccaaa       360
     cgataccgct tccacgctgc cttgatcaac acctgtctgg gcatccagat cgtggtcgct       420
     gctgcactga cagctctcgg tgcggcgcgc ggccctcaca atgctgtaac tgctttcggc       480
     gccatcaaca ctatcgtcgc cggtattctc acctacctga aaggctcagg ccttccagac       540
     cgcttgaaac actatcagaa cgaatggcgc aacattcggg aatacattga acagcgagaa       600
     cgtgaattat gtctagaagg atgtggcctg gacgttgaag aagagatccg gattatcgag       660
     caaatgtacg aaggtgtcaa acgcgagatc gaggcgacaa agagcggggg cgacaacagg       720
     tcattcagtc gtgacaggac gtctacccga cgaccagtga tccagcaaac agagcaaagt       780
     agggaatacg cccctcgtcg ttcgccgagt cccgcaagga cttcagaagc ctttgagaag       840
     cattaccacg agccacgaag ggaattcacc cctcgaccgc cgagtcctgc aagagtgcac       900
     gagcgtttcg agaaacacta ttag                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page