(data stored in ACNUC16935 zone)

EMBL: BN001307.PE408

BN001307.PE408       Location/Qualifiers
FT   CDS_pept        complement(join(1132664..1132912,1132968..1132991))
FT                   /locus_tag="ANIA_11307"
FT                   /old_locus_tag="AN11307.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008192"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008192"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008192"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN02"
FT                   /protein_id="CBF85117.1"
FT                   /translation="MPGRQRIQHKQDEPVPDYEALEAEARRYKHAVFLLVETIRKNSPA
FT                   DTLELIDAIRNTKSVSEAAGLVMQLSETASSPEGGTQRDSEARSQ"
     atgcccggcc gacaacgtat ccagcacaaa caagacgaac cagtcccgga ctatgaggcc        60
     ctggaagcgg aagcaagacg gtacaaacac gcggttttcc tactcgtcga aacaatccgg       120
     aaaaattctc cggcagacac cctcgagctc atcgacgcca tccgcaacac caagtcggtt       180
     tcagaggccg ctgggcttgt gatgcaactg tcagaaactg ctagctcacc tgaaggaggt       240
     actcaaagag attcagaggc gcgctctcaa taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page