(data stored in ACNUC16935 zone)

EMBL: BN001307.PE41

BN001307.PE41        Location/Qualifiers
FT   CDS_pept        join(112517..112928,112979..113277,113327..115618)
FT                   /locus_tag="ANIA_09021"
FT                   /old_locus_tag="AN9021.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007832"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007832"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007832"
FT                   /db_xref="GOA:Q5ARQ9"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ9"
FT                   /protein_id="CBF84445.1"
FT                   /translation="MRRALFNEDDAKQARERRLKYQGTARVKISEIGFDSANYIDDKNV
FT                   ERLCGIFRKSGCRRFDVEHHIPATVSRNALAEALQKAGVPARALLLSSGEDTPFLTFSR
FT                   GQLVGLHGRHRLSAGARVLAPLERWWTVDLFLDDISKDLRVSLVEEYSNQKKLTDGEIY
FT                   WTIRQYESEGSSLLRQKWFTRLSDWKQKRIKQLDREENRQLREAFDRLLTIQGLWYDGM
FT                   RLGMIHRLIALAATEEILTYFDHIYETYLFFVNGDRGSLNRIDTETVLGLQLKCPRVCE
FT                   KDRKEVNGLVLSGQVFSSFSESERRNICRRLQSFDGIIPSLYTFWEDFKYLECCAQCIR
FT                   RLFGQVNGSIWNTMKHMFVGTADEDYGIVQTSEFSFRRQTAGNNERLDLGYRQLWLYAM
FT                   RNYRLLPQPAKEEEELLVKPSRREADDRVLYEMAELARRLGFWSDEIRALLDGSPDRQI
FT                   ARAALLQARKPDQFQYDPVQLEGLVDRVVACFSAAIEYVRQPPELLADSEVSTRARRGL
FT                   PQVKAHAQDAPHLFLDKVHNEVTSSSATLTTFFVRRCVYFAFFGKCSLSGSRVRDLGPG
FT                   GPPGDTPGLFVNENMQTTGASSTVPESTVAQGSGTRPTHEDIPTRQRLEGHSEPILEDG
FT                   VGRSSQLALSGENTGYDEMADEGTRSHSPANQVATSGIPESLSLGLQRVSSADASSLNG
FT                   EQLGHQNAEQTPLSRDSDWPSTPAESNLDTSLGEQPQPMDYSPSIYSVRESGARNTGTG
FT                   AERQYSQELERAIQERERLDNDWERERLEQELGLPTSSSAQGEIAPVQCSKEDEVPETL
FT                   RQTVEPPDGSDQEPSSSNVGTNDQQTREPLTQGDRPVTLLDIHNSALVPSGRQGGQSPT
FT                   AGAFEDSRVEDRMELVEFTFWSLERGQWRRADHLWVDPADTFRVELIAKKYIWKDFSLY
FT                   DRHWNSLSPAQCFRAATVDGSNAIFVVSEDEERRLQAEGRRMKMTQIQAISHRAGSDPT
FT                   EPERQLKRNRL"
     atgcgacgtg ctctcttcaa cgaagacgac gcaaaacagg ctcgtgagcg gcgtctgaaa        60
     taccagggga ctgctagggt caaaatatca gaaatcggat ttgattccgc aaactacata       120
     gatgacaaaa atgtggaacg gctttgtggt atattccgaa agagtgggtg tcgccgattt       180
     gatgtcgaac atcatatacc tgctacggta tcgcgaaatg cgttggcaga ggcattacaa       240
     aaggccgggg tgcctgcgcg agcgctttta ctgagttccg gggaggacac tccatttttg       300
     accttttcaa gaggccagct cgtggggctc cacggtcgcc atcgcttgtc cgctggggct       360
     agagtgttgg cgcctctgga gagatggtgg actgtagacc tctttctaga cgatataagc       420
     aaggatctta gagtatcgtt ggttgaagaa tattcaaacc aaaagaaact aacagatggt       480
     gagatatact ggacaatccg tcaatacgaa agcgaaggaa gcagccttct gcgtcaaaag       540
     tggttcacac gcttgtctga ttggaagcag aagcgaataa agcaactaga tcgagaagaa       600
     aataggcaat tacgcgaagc tttcgatcgg ttgcttacaa ttcagggtct ctggtacgat       660
     ggaatgagac ttggaatgat ccatagactc attgctctcg ctgctaccga ggagatactc       720
     acttattttg atcacatcta tgagacatac cttttctttg tcaatggcga ccgaggttca       780
     cttaatcgta ttgatactga gaccgtgctc gggttgcaac tgaaatgccc tagagtttgc       840
     gaaaaggaca gaaaagaagt gaacgggctt gtgctaagcg gtcaagtatt ttcctcgttc       900
     agtgaatctg aacgcagaaa catctgtagg cggcttcaaa gcttcgatgg gatcattcca       960
     tcgttgtata ctttctggga ggatttcaag tatcttgaat gctgcgcaca atgcataagg      1020
     aggctttttg gtcaggtgaa tggatcgata tggaatacga tgaagcatat gttcgtggga      1080
     actgcagacg aagattacgg catcgtccaa acctccgagt tttcatttcg tcgccagacc      1140
     gcaggcaata acgaacgact tgatctaggc tacaggcagc tctggctgta cgcaatgcgc      1200
     aactaccgtc tcctgcctca gccagccaag gaagaggaag agctcttggt caagccaagt      1260
     cgtcgcgaag ctgatgaccg cgtcctttac gaaatggctg aactggcccg tcgcctaggg      1320
     ttctggtcgg atgagatccg tgccttgcta gacggttcac cagatcgcca gatcgcgcgt      1380
     gctgcgttgc tacaggctcg caagcctgat caatttcagt atgatcctgt tcaactggaa      1440
     gggcttgtcg accgtgttgt tgcgtgtttt tcagcagcca ttgaatatgt tcgccaaccc      1500
     ccagagcttc ttgcggacag tgaagtgtcc acaagagcac gacgtggatt gccacaggtg      1560
     aaagcccacg cccaggatgc tccacacctg ttccttgata aagtccataa cgaagtcacg      1620
     tcctcatccg ccacgttgac cacgttcttt gttcgacgtt gtgtatattt cgctttcttc      1680
     gggaaatgtt cgctcagtgg atctagggtt agagacttag ggccaggtgg ccccccaggg      1740
     gatacaccag gtctctttgt caatgagaac atgcaaacaa caggagcttc ctccactgtt      1800
     cctgaaagta ctgttgctca gggttcggga acccggccga ctcatgaaga tattccaacc      1860
     cggcagcgcc tcgaaggaca ctcagagccg atactcgaag acggtgtcgg cagatcctct      1920
     cagttagcgc tttcgggtga aaacaccgga tatgatgaaa tggccgatga gggtacaaga      1980
     tcacactcgc cagcgaatca agttgcaact tctggaattc ccgaaagcct ttcgctcggt      2040
     ctccagcggg taagctctgc agatgcttct agccttaatg gcgagcaatt gggacatcag      2100
     aatgcggagc agaccccact ttctcgtgat tcagactggc catcaacccc ggcagaaagc      2160
     aatctggaca cttcattggg agagcaacct cagcctatgg attattctcc ctccatatat      2220
     tctgtacggg agagtggagc ccggaatact ggaactggag cagaacgaca gtattcccaa      2280
     gaacttgaaa gagcaatcca agaacgagag agactcgaca atgactggga acgagagaga      2340
     ctagaacaag agctgggtct cccgacgtct agtagcgcac agggtgagat tgcgcctgta      2400
     caatgcagta aggaggacga ggtacccgag acgttacgac agacagtcga acctccggat      2460
     ggttctgatc aggagccctc ttcatccaac gtgggaacaa acgaccaaca aaccagagag      2520
     ccactcaccc aaggagatcg gccggtgact ctactcgata tccacaattc tgccttagta      2580
     ccatcgggaa gacaaggagg tcagtccccc acagcgggcg ccttcgagga ttcccgcgtg      2640
     gaagatcgga tggaactagt tgagttcacc ttctggtcac ttgagagagg acaatggcga      2700
     agagcagacc atctatgggt tgatcctgct gacaccttcc gcgtagagct gattgccaag      2760
     aaatacatat ggaaggactt ttcattgtat gatcgccact ggaatagcct cagccctgcg      2820
     cagtgtttcc gtgcagcgac cgtggatggc agcaatgcta tttttgtggt gtcggaggat      2880
     gaggagcgga gactccaagc cgagggaaga agaatgaaaa tgactcaaat tcaggcaata      2940
     tcccacagag ccggttcgga ccccacggaa ccggagaggc agttaaagag gaaccgtctc      3000
     taa                                                                    3003
//

If you have problems or comments...

PBIL Back to PBIL home page