(data stored in ACNUC16935 zone)

EMBL: BN001307.PE410

BN001307.PE410       Location/Qualifiers
FT   CDS_pept        complement(join(1137168..1138981,1139031..1139413,
FT                   1139461..1139867))
FT                   /locus_tag="ANIA_01564"
FT                   /old_locus_tag="AN1564.4"
FT                   /product="DNA mismatch repair protein, putative
FT                   (AFU_orthologue; AFUA_8G05820)"
FT                   /note="transcript_id=CADANIAT00008194"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008194"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008194"
FT                   /db_xref="GOA:Q5BD16"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD16"
FT                   /protein_id="CBF85120.1"
FT                   /translation="MPIVALPPATVRAIGSTSIISDPYSLAKELLDNALDAFATLVSVE
FT                   ISQDTVGLLQVKDNGHGIPADDYMVVCKRTFTSKIHTVEDLQKVGGKSLGFRGEALASA
FT                   AELSGALNISTRVETDPVGSSLEYGRNGELTRTERISHPVGTTVRILNLFQQIPVRRQT
FT                   AIKNSKKTLLKIKKMVQAYAMARPSIRLSFKVLKAKNESLNWMYAPGENGTLTEAALRV
FT                   GGTGIAPNCILKNWPTPSKDGNASPEDLGFRLVALLPKVGSDITKFNNLGQYISVDNRP
FT                   LSSGRGFAQDITKLFRRYLRSAASRDGLSPPINDPFLCVHVLCLGGAYDANIEPSKDDV
FT                   LFENQQAVLSLVEDLLRDTYGDLSNVHEDHGSTGQGRGTSQRNGFEALLSKKQQSAALS
FT                   TPALDSSPQERSSVSARLFARPESCRSPPEPHSCGEQADRSLLTRLNNPRATMGTASPV
FT                   VDAQDQGRLSLHKKIHLPGININPRETRQRDDVRPCLPSPTSSADSPAAALNTTPSSSL
FT                   GPSQLSPATSARDRQQQRQIGRERYGNGSLDTWFLKLSQSSQSPAATEEPETQIEDPPL
FT                   SQLTQDYFGTERARPNGTSDLANNPSQTASEISLQDSLADSGSTEGSPRTLARPARFVN
FT                   KPGLPVLEQWSARLYSAASPEENPELQKALEFETRKKAAIQERRMQLQNPKPTTSKNSP
FT                   HQSRYLAARAALSSQPRPSSVTQQSRSELGEISSHGTGVSKTFLSPQDPRAYLIQLQNS
FT                   DVPGGPKLKRISSAKLPFEKIPEEHDLHSMGLTLPAGLPLIYSSFKNLWINDLYTQSGE
FT                   QVEGFVSPDIKTAFESWDAHLSSLIRARYRLAKNSDIPNLQFDFSELSRVSQGSG"
     atgccgattg tggctcttcc acctgccact gttcgggcca ttggctcaac atctatcatc        60
     tctgacccgt actcactggc gaaagagctg ctggacaatg ccctagatgc atttgcaact       120
     ttagtgtctg tcgaaatttc gcaggacacg gtcggccttc ttcaggtcaa agacaacgga       180
     catggaattc ctgcagacga ctacatggtt gtatgcaaac gcaccttcac aagcaagatc       240
     catactgtcg aagacttgca gaaagtaggc gggaaatcgc ttggattccg tggtgaagca       300
     ttggccagtg ctgctgagct atctggtgct ctgaatattt ccactagggt cgagacagac       360
     cctgttgggt cctctttgga gtatggcaga aatggggagc ttaccaggac tgaacgtatc       420
     tcccatcccg ttggaacgac tgttcgcatt ttgaacctgt ttcagcagat accggttcgg       480
     cggcagaccg ctatcaagaa ctccaagaaa acgctgctca agatcaagaa gatggtgcag       540
     gcatatgcca tggctaggcc ttctatcaga ctgtctttca aagtcctgaa ggcaaaaaac       600
     gaaagtttaa actggatgta tgccccaggg gaaaatggta cgctcacgga ggcagcattg       660
     agggtcggcg gtactgggat tgcccctaac tgtatcctca aaaactggcc aactccctct       720
     aaagatggga atgcctcacc agaagacttg gggttcagac tagttgcgct actccccaaa       780
     gtcggctcag atatcaccaa gttcaacaat ctaggtcaat acataagtgt ggacaatagg       840
     ccactttcat cggggcgagg atttgcgcag gatattacaa agctctttag aagataccta       900
     cgttctgccg catcgcgcga tggtctgtcg ccgccaatca acgatccttt tctttgcgtt       960
     catgtcctgt gccttggagg agcttatgat gccaacatcg aaccatccaa agatgatgtc      1020
     ttatttgaga atcaacaggc tgttctttct ctggtggaag atctcctccg agatacctat      1080
     ggcgatctgt cgaatgtgca cgaggatcat ggctcgactg gacagggcag gggaacgtcc      1140
     cagcgaaatg gattcgaagc tctcctgtcc aaaaagcagc aaagtgctgc actctccacc      1200
     cctgccctgg attctagtcc acaagagaga agttccgtga gcgcccgcct gttcgcacgt      1260
     ccggaatcct gtcgcagccc tccggagcct catagttgtg gagaacaagc tgaccgctca      1320
     ttattaactc gacttaataa cccgagggcc acaatgggaa ctgcatctcc tgttgttgac      1380
     gcacaagatc aaggacgact aagtctacat aaaaaaattc acttgcctgg aatcaatata      1440
     aatccacgcg agacaagaca gcgtgacgat gttcgtccat gcttacccag cccaacatct      1500
     agcgcagact ctcccgctgc agctttgaat accactcctt cctcgagtct aggtccatcg      1560
     cagctttcac cagcaacttc ggcgcgggat cgccagcaac agaggcagat tggcagggaa      1620
     cgttacggaa acgggtcatt ggatacctgg tttctgaagc tgtcacagtc atcgcagtct      1680
     cctgcggcta ccgaagaacc agaaacacag atcgaggatc ctccgctatc tcagctcacg      1740
     caggattatt tcggtactga gagagcaaga ccgaatggca catccgatct ggcaaacaat      1800
     ccatcccaaa ccgcctcgga gatcagcctg caagactctt tagcagattc aggctccaca      1860
     gaagggtctc cacgcaccct agcacggcct gcaaggttcg ttaacaagcc tggattacct      1920
     gttcttgaac aatggtcagc caggttatac agcgccgcga gtcccgagga gaaccccgag      1980
     ctccagaagg ctctcgaatt cgaaacaagg aagaaagctg ccattcaaga acgtcgaatg      2040
     cagcttcaga accccaaacc tacaacttca aaaaactctc cccatcagag caggtacctt      2100
     gccgctcggg ctgccttgag ctctcagcct agacctagtt ctgtcacgca gcagtcgcga      2160
     tcagaattgg gcgagatttc atcacacggc accggggtgt caaagacgtt tctaagcccg      2220
     caagatccaa gggcatacct catacagctc cagaacagtg atgttcccgg tggtccaaaa      2280
     ctcaagcgga tatcgtctgc caaattgcct tttgagaaaa tccccgagga acatgactta      2340
     cattctatgg gccttacatt acctgcaggg ctgccgttga tctattcatc tttcaagaac      2400
     ttatggatta atgatctata tacgcagtct ggtgagcagg tcgaggggtt tgtttctcct      2460
     gatataaaga cggcttttga aagctgggac gcccacttat cgagtttaat tagagctcgt      2520
     tatagattgg cgaagaactc tgatatcccg aatcttcaat tcgatttctc cgaattgtct      2580
     cgggtatctc agggcagtgg ttaa                                             2604
//

If you have problems or comments...

PBIL Back to PBIL home page