(data stored in ACNUC16935 zone)

EMBL: BN001307.PE411

BN001307.PE411       Location/Qualifiers
FT   CDS_pept        join(1140151..1140485,1140535..1140706,1140753..1141052,
FT                   1141102..1141180,1141227..1141648)
FT                   /locus_tag="ANIA_01565"
FT                   /old_locus_tag="AN1565.4"
FT                   /product="Palmitoyltransferase pfa4 (EC 2.3.1.-)(Protein
FT                   fatty acyltransferase 4)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD15]"
FT                   /note="transcript_id=CADANIAT00008195"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008195"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008195"
FT                   /db_xref="GOA:Q5BD15"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR033682"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD15"
FT                   /protein_id="CBF85122.1"
FT                   /translation="MLCSSFSVSRLAIPAVCILIAFLAYTSQIFFLYFEDAPLKEDEVW
FT                   RINILAICIWICYYRACTVDPGHVPKGWMPSDRERLKADRASGRQRWCRRCEAYKPPRA
FT                   HHCKTCERCVPKMDHHCPWTSNCVSHFTFPHFARFLFYAVVGIAYLETRLWQRVSKVWG
FT                   SRHLPSYLGPSMGQIGHLFVLFVTNSLTLFALSLLLLRTLWSLGSNTTTIESWEIERHE
FT                   TLLRRARRLGGSLPGPGGISVHITKQEFPYDIGIWSNIRAGMGGSANVLSWFWPLARTP
FT                   DRSTGLEFEENGFEDPTVSWPPPDPDRIPLPPMDQRDSFMYDITDTSGTSGQIDIEAFN
FT                   RRKEADLRRRRAPTEIERRKPFHVRLEEYSNGSSDAEADTGSDDDSDHGEEGWKNSEGE
FT                   RLRDFGVDEEAEFYDEEDIPLALLIQQRAKRQHLSQ"
     atgctgtgct catcattttc tgtctcgagg cttgcaatac cagctgtttg tatattgatt        60
     gcgtttctcg cgtacacatc gcagatcttt ttcctgtact tcgaggacgc accgctgaaa       120
     gaggacgaag tatggcgaat caacattctt gccatatgca tttggatttg ctattatcgc       180
     gcttgcacag ttgatcctgg tcatgtgccg aaagggtgga tgccatcgga ccgtgagcgg       240
     ttgaaggccg atcgagctag cggtcgtcaa cgatggtgtc ggaggtgcga agcctataaa       300
     ccaccaagag cacatcattg caagacatgt gaaaggtgtg tcccgaaaat ggaccatcac       360
     tgcccatgga cctccaactg tgtctcacac tttacctttc cgcatttcgc gcgatttctg       420
     ttttatgcgg tagtcggtat tgcgtatctc gagactcgtc tctggcagcg tgtctccaaa       480
     gtttgggggt caaggcacct gcccagttat ctaggaccta gcatgggaca aatcggccat       540
     ctattcgtcc tattcgtcac caacagcttg accctgtttg cactctctct gcttcttctg       600
     aggactctct ggtcgctcgg gtcgaacaca actaccatcg aatcgtggga aatcgaacga       660
     catgaaaccc tgcttcgacg cgctcggcgt ctcggcggca gcttgcccgg gccagggggc       720
     atcagtgtgc atataacgaa gcaggagttt ccctatgata taggtatctg gtctaatatc       780
     agagctggaa tgggcggaag tgccaatgtg ctaagctggt tttggccgtt ggcaaggacg       840
     cctgaccgta gcacgggatt agagttcgag gagaacgggt tcgaagatcc tactgtttca       900
     tggccaccgc cagatccaga tcgcatccct cttccaccca tggatcagcg agatagtttc       960
     atgtacgaca ttacagacac aagcggtaca agcggtcaaa tcgacattga agcttttaat      1020
     agacgaaagg aggcagacct aagacgtcgg agagcgccga ctgaaattga gcgccgcaag      1080
     ccgtttcatg tacggttgga ggaatactca aatggctcgt ctgatgccga ggctgatacc      1140
     ggaagcgacg acgactccga ccacggcgaa gaaggttgga agaactctga aggagaacgg      1200
     ctgcgtgatt tcggcgttga cgaagaggct gagttctacg atgaagagga tatccctttg      1260
     gctttgttaa tacagcagcg agcaaagcgc cagcacctat cacaatga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page