(data stored in ACNUC16935 zone)

EMBL: BN001307.PE412

BN001307.PE412       Location/Qualifiers
FT   CDS_pept        complement(join(1141704..1142205,1142278..1142561,
FT                   1142617..1142670))
FT                   /locus_tag="ANIA_01566"
FT                   /old_locus_tag="AN1566.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008196"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008196"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008196"
FT                   /db_xref="GOA:C8VN06"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN06"
FT                   /protein_id="CBF85124.1"
FT                   /translation="MSATQQTQAERKDNWSSEAYSASAAFVPKLTQTLLQYLDPQPSDS
FT                   VLDIGCGDGKFTELFLPYVSKVLGVDSSPAMIEAARKGYGSEKAEFQVLDCCFLEQNSD
FT                   VADGTWDKVVSNAALHWILRNEKTRLSTLKGIHASLKKGGAFVFEMGGHGNVAEIQAAM
FT                   QYALLRQGISIEKARESYPWFFPSVPWMSSTLESLGFKVVKMESEYRPTKLTSDTNGGL
FT                   AGWVRLMGAAFLDVVDTEKREEVIREVCEVLQTVTTREEDGSQWLGYVRLRGVAVKI"
     atgtccgcga cccaacaaac ccaagctgag cgtaaggaca actggtcatc cgaggcctac        60
     tcagcatccg ctgccttcgt cccaaaacta acccagactc tgctccaata tctcgacccg       120
     cagccttccg acagcgtctt ggacatcgga tgcggcgatg gaaaattcac cgagctcttc       180
     ctaccctatg tttccaaggt tcttggcgtg gattcctcgc cggcgatgat cgaggctgcg       240
     aggaagggct acggcagtga gaaggccgag ttccaagttc tggattgttg cttcttggag       300
     cagaatagcg acgttgcgga tggaacatgg gataaagttg tttccaacgc ggccttgcac       360
     tggatcctcc ggaatgaaaa aacacgcctc tcgacattaa agggcatcca cgcgtctctg       420
     aaaaagggag gcgcattcgt ctttgaaatg ggcgggcacg gtaacgtcgc cgagattcag       480
     gctgcaatgc agtacgccct tctccgacag ggaatctcca tagagaaagc ccgcgaatcg       540
     tatccgtggt tctttccgtc tgtaccctgg atgtcgagca ccctggaaag tcttgggttc       600
     aaagtagtga agatggagag cgagtatcgg ccgacaaagc tgactagtga cactaatggg       660
     gggttggcag ggtgggtgag gctcatgggg gcggcatttc tggacgttgt ggataccgag       720
     aagagagaag aggtgatacg ggaagtctgc gaggtgttgc agacggtgac aacccgcgaa       780
     gaggatggga gtcagtggct agggtatgtt aggcttaggg gtgtcgctgt taagatctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page