(data stored in ACNUC16935 zone)

EMBL: BN001307.PE413

BN001307.PE413       Location/Qualifiers
FT   CDS_pept        join(1144464..1144768,1144844..1144920,1144975..1144994)
FT                   /locus_tag="ANIA_01567"
FT                   /old_locus_tag="AN1567.4"
FT                   /product="MBL2-like secreted peptide, putative
FT                   (AFU_orthologue; AFUA_5G00910)"
FT                   /note="transcript_id=CADANIAT00008197"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008197"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008197"
FT                   /db_xref="GOA:C8VN07"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN07"
FT                   /protein_id="CBF85125.1"
FT                   /translation="MKFTVAGVLALASLALAMPAPEAAAVAEAEALEAPVPVDISPEAL
FT                   GLEKRANTVCKIVNSSSSKVNCRTGPGFDYPASYSVIPGKYYEFRCYKSGDCYNGNCTW
FT                   QRINWDGKTCYVNGYYTDSKCTVAALGKC"
     atgaaattca ctgtcgccgg agttcttgcc ctcgccagcc tggccctcgc catgcctgcc        60
     cctgaggcag ccgccgtcgc ggaggcagag gccctcgagg cccctgtccc cgtcgacatc       120
     tcccctgaag ctttgggcct tgaaaagcgc gccaatactg tgtgcaagat cgtcaactcg       180
     agttcctcca aggtcaactg ccgcaccgga ccgggctttg actatccagc ctcgtactct       240
     gtgatccccg gcaagtacta cgagtttagg tgctacaagt ctggagactg ctataacggc       300
     aactgcacct ggcagcgtat taactgggat ggcaagacct gctatgtcaa tggctactac       360
     actgatagca aatgcactgt tgctgctctt ggaaagtgct ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page