(data stored in ACNUC16935 zone)

EMBL: BN001307.PE414

BN001307.PE414       Location/Qualifiers
FT   CDS_pept        complement(join(1146366..1147412,1147482..1148045,
FT                   1148094..1148294))
FT                   /locus_tag="ANIA_01568"
FT                   /old_locus_tag="AN1568.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008198"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008198"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008198"
FT                   /db_xref="GOA:C8VN08"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN08"
FT                   /protein_id="CBF85127.1"
FT                   /translation="MGKGKPRLLLNHRPSIHPSKMQIKSGYYIGIDVGTGSARACIIDH
FT                   NGDIVGLASKDIGLWQPEQQHYEQSTLNIWQCICASVQQALAERAIPSSQVHGIGFDAT
FT                   CSLAVFSKTTNKPVSVTRQGGFSTERNVILWLDHRAVKETELINATGHKVLKYVGGTMS
FT                   PEMEMPKILWLKNQMPPEVFADCKFYDLVDALTHIATGEETRSYCSLVCKQGYLPSQVE
FT                   GSTTGWQGDFLESIGLGELAADGFARIGGVNGETGQHLSAGERAGRLSARAAKELGLPP
FT                   GIAVGAGVIDAYAGWIGTVGTKIDGVDVVGNHNRADAFNRLAAVAGTSTCHIAMSSNPV
FT                   FVPGVWGPYRDTVFRGCWMAEGGQSATGQLLKHVLDTHPASKSAFAVAADRGLDIFSFL
FT                   DGHLAALAAKQNLPCIAALARHFFFYGDFFGNRSPLADPNMTGSVVGLTADTSIDSLAI
FT                   HYYGTLEFIALQTRQIVETMNKAGHAITSIFMSGSQCKNRTLVKLIATACNMPVIVPRG
FT                   RHVEAAVCHGAAMLGVKAANLDAPGKTVDLWDVIEQTSKPGDVCHPTTAEYERALLAAK
FT                   YQVFLDQCTRQREYREMVDRVAFPNQV"
     atgggtaagg gtaaacctcg cctactgctg aatcatcgtc catccattca tcctagcaag        60
     atgcagatta aatcaggcta ctacatcggc atcgacgtcg gcaccggcag cgctcgcgcc       120
     tgcatcatcg atcacaatgg cgacattgtc ggcctggcat ccaaggacat tgggctctgg       180
     caaccagagc agcagcacta cgaacaatcg actctgaaca tctggcaatg catttgcgcc       240
     tcagtccagc aagccctagc cgagcgtgcc atcccttcct cccaggtcca cggcatcggc       300
     ttcgacgcaa cctgttcact cgctgttttt tccaagacaa caaataaacc cgtctcggtg       360
     acccgtcaag gagggttcag taccgagcga aacgttattt tatggcttga ccaccgcgca       420
     gtcaaggaga ctgagctgat caatgctaca gggcacaagg tgctcaagta tgtcggcggc       480
     accatgtcgc ctgagatgga aatgcccaag atcctatggc tcaagaacca gatgccgcca       540
     gaagtgtttg ccgactgcaa gttctatgac ctggttgatg cgctaacaca tattgcgacg       600
     ggcgaggaga cgagaagcta ctgtagtttg gtgtgtaagc aggggtatct gccgagccag       660
     gtggaaggga gtacgactgg gtggcaaggg gactttctag aaagcattgg acttggagag       720
     cttgctgcgg atgggtttgc gcgtattggg ggcgtgaatg gggagaccgg ccagcacctc       780
     agcgcaggcg agcgtgctgg gagactctcc gcacgcgcag cgaaggagct cggtctgccc       840
     cctgggattg ccgtcggggc tggggtgatc gatgcctatg cagggtggat tggcactgtc       900
     ggcaccaaga tcgatggcgt tgacgtagtg ggcaatcaca acagggcaga cgctttcaat       960
     cgtctcgccg cagtagcagg gacatcaacc tgccacatcg ccatgtcttc caatccggtt      1020
     ttcgtccccg gcgtatgggg tccatatcgc gataccgtct tccgtgggtg ctggatggcc      1080
     gaaggaggcc agtctgccac gggtcagctg ctgaaacatg ttctcgacac ccatcccgca      1140
     tcgaaatctg cctttgccgt tgctgctgac cgcgggttgg atattttttc gtttctagac      1200
     ggccatctcg ctgcactagc tgcgaaacag aacctaccgt gtatcgccgc tctcgcccga      1260
     cacttcttct tctacggcga cttcttcggg aacagatcac ccctggcgga cccgaacatg      1320
     accgggtccg tcgttggtct cactgccgat acctcgattg acagcctggc catacattac      1380
     tacggcacgc tcgagttcat cgcactgcag acgagacaaa tcgtcgagac gatgaacaag      1440
     gctgggcatg ctattacctc gatctttatg tctggatcgc agtgtaagaa taggactcta      1500
     gtcaaactca tcgccacggc gtgcaacatg cccgttattg tcccgcgagg ccgccacgtc      1560
     gaggccgcgg tgtgtcatgg agcagccatg ttgggcgtca aggcggctaa tctggatgcc      1620
     ccggggaaga ctgtggactt gtgggatgta attgaacaga cgagcaaacc cggggatgtc      1680
     tgtcatccaa caacggcgga atacgaaagg gcactgcttg ctgcaaagta tcaagtgttt      1740
     ctggaccaat gtacacggca gcgcgagtat cgagagatgg tggacagggt agcctttccg      1800
     aatcaagtgt ag                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page