(data stored in ACNUC16935 zone)

EMBL: BN001307.PE417

BN001307.PE417       Location/Qualifiers
FT   CDS_pept        1154744..1156180
FT                   /locus_tag="ANIA_10218"
FT                   /old_locus_tag="AN10218.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008201"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008201"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008201"
FT                   /db_xref="GOA:C8VN11"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN11"
FT                   /protein_id="CBF85132.1"
FT                   /translation="MPTTSRHKHRIYFAYGINMHLKQMAKRCPNTRYLGVAKLSGYRWQ
FT                   INERGYANVIEASAESRASPTTVQGLCYLIGAEDELKLDRVEGVPTAYQKRVLRVELVL
FT                   AKSSLVGRDVSEIASFSGEELKAGSGRGEAEVVEALAYVSKDYIKDGPPKGEYVARMRL
FT                   GLRDALELGMSKEYARVIERVVAVGMRGAGAGGMGRPPATSPRPRPQPSRTAAPRASPP
FT                   TSPASASYYYFAFGSNMQLAQMADRCPGSKVFAKGILPGYRWHINERGVANIVATATQD
FT                   GNDNAVQGILFTVTPKDVKTLDKKEGIAKGYYEKIVLRVKVEPLAISGLKGVKTVVAAG
FT                   KLASNSQAEAREPRKHRHGQDQHGQRAEVAGVREVEALVYLSSQYKKDGRVRAEYVGRM
FT                   QLAMADALKLGVDEAYLRASLHSCILGVDEAAVSAHGKRDFIVRQPAGDASGAAQTSGS
FT                   PKDRRIIERVPAGTGYQAAA"
     atgcctacta cttcgcgcca caaacacaga atctactttg cctacggtat caatatgcac        60
     ttgaagcaga tggccaagcg atgccccaac acgcggtatc tcggtgttgc aaagctctcc       120
     gggtacagat ggcaaatcaa cgagaggggc tatgcgaatg tcatcgaggc gtcggcggag       180
     tctcgagcga gtccaactac agttcagggc ctctgctatc tcatcggcgc cgaggatgaa       240
     ctgaaacttg atcgtgtcga gggcgtcccg acggcatatc agaagagagt gcttagggtg       300
     gagctagttc tcgcgaagtc aagtctggtt ggcagagatg tgagtgagat tgcgagtttc       360
     tctggtgaag aactgaaggc tggatctgga cgtggtgaag ccgaagtggt tgaagcactc       420
     gcatatgtga gcaaggatta tatcaaggat ggtcccccaa aaggcgagta tgttgctaga       480
     atgcgattgg gactgaggga tgcgcttgag ctggggatgt cgaaagagta tgcccgggtt       540
     atagagagag tggttgctgt gggtatgcgt ggtgcaggtg caggcggtat gggcagacct       600
     ccagctacat ctccacgacc acgaccacaa ccaagtagaa cagctgctcc tcgagcgagt       660
     cctcctacgt ccccggcgtc agccagctat tactatttcg ccttcggcag caatatgcaa       720
     ctcgcacaga tggcggaccg gtgtcccggc agcaaggtct tcgcaaaggg cattctccca       780
     gggtatagat ggcatatcaa cgagagaggg gtcgccaata tcgtggccac ggcgacccag       840
     gatggcaacg ataatgctgt ccagggtatc cttttcacag tcactccaaa agacgtcaag       900
     acgcttgaca aaaaggaagg gattgcaaag ggttactacg agaagatcgt gcttcgtgtg       960
     aaggtggagc cgttagccat ctccggactg aaaggtgtaa agactgttgt cgcggccggg      1020
     aagctggcct caaactcgca ggctgaggct cgagaaccac ggaagcacag acacggacag      1080
     gatcagcatg gccagcgtgc agaagtggca ggtgtgagag aggtcgaagc cttagtgtat      1140
     ctcagcagcc agtacaagaa ggacggccgc gtccgtgccg agtatgtcgg gcgaatgcag      1200
     ctggctatgg cggatgcgct gaagctcggt gtcgatgagg cctatctgcg agcttcgctt      1260
     cattcatgca tacttggtgt agacgaagca gcagtctcag cccatggtaa gcgggatttc      1320
     attgtcaggc agccggctgg cgatgcaagt ggtgcagcgc agacgagtgg aagccctaag      1380
     gaccgccgca tcatcgaaag agtgccagct ggaacgggat atcaggctgc tgcttga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page