(data stored in ACNUC16935 zone)

EMBL: BN001307.PE418

BN001307.PE418       Location/Qualifiers
FT   CDS_pept        complement(1156388..1157920)
FT                   /locus_tag="ANIA_01571"
FT                   /old_locus_tag="AN1571.4"
FT                   /product="Alpha-L-arabinofuranosidasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:O74288]"
FT                   /note="transcript_id=CADANIAT00008202"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008202"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008202"
FT                   /db_xref="GOA:O74288"
FT                   /db_xref="InterPro:IPR007934"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015289"
FT                   /db_xref="InterPro:IPR036195"
FT                   /db_xref="InterPro:IPR038964"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74288"
FT                   /protein_id="CBF85134.1"
FT                   /translation="MTMSRSSRSSVLALALATGSLVAAGPCDIYSSGGTPCIAAHSTTR
FT                   ALYSSYNGPLYQVQRASDGTTTTITPLSAGGVADASAQDAFCENTTCLITIIYDQSGNG
FT                   NDLTQAPPGGFNGPDVGGYDNLAGAIGAPVTLNGKKAYGVFVSPGTGYRNNEAIGTATG
FT                   DEPEGMYAVLDGTHYNDGCCFDYGNAETSSLDTGNGHMEAIYYGTNTAWGYGAGNGPWI
FT                   MADLENGLFSGQSSDYNAGDPSISYRFVTAILKGGPNLWALRGGNAASGSLSTYYNGIR
FT                   PTDASGYNPMSKEGAIILGIGGDNSVSAQGTFYEGAMTDGYPDDATENSVQADIVAAKY
FT                   ATTSLISGPALTVGDTVSLKVTTSGYDTRYIAHTGSTINTQVVSSSSSSTLKQQASWTV
FT                   RTGLASTAAANGCVSFESVDTPGSYIRHSNFALLLNANDGTKLFSEDATFCPQDSFNDD
FT                   GTNSIRSWNYPTRYWRHYENVLYVASNGGVNTFDAATAFTDDVSWVVADGFA"
     atgaccatgt ccaggtcctc acgatcttcc gtccttgccc tagctcttgc cacgggttct        60
     ctcgtcgccg ccggtccctg cgacatctac tcgtccggcg gcaccccgtg tatcgcagcg       120
     cacagtacca cgcgcgccct ctacagctcc tacaacggcc cgctgtatca ggtgcagcgc       180
     gcctcagatg gtaccacgac caccatcacc ccactctctg ccggcggggt cgcagacgcc       240
     tcggcgcagg acgccttctg cgagaacacg acctgcctca tcaccatcat ctacgaccag       300
     tcaggcaatg ggaacgatct gacccaagct ccgccgggtg ggtttaacgg ccccgacgtg       360
     ggcgggtacg ataaccttgc gggagctatc ggagcccctg ttactctgaa cgggaagaag       420
     gcgtatggag tgttcgtctc accgggcact gggtacagga ataacgaggc cattgggaca       480
     gcgacgggtg atgagcccga gggaatgtac gctgttcttg atgggaccca ttataacgac       540
     gggtgctgct ttgactatgg caacgcggag accagcagtc tcgataccgg caacgggcac       600
     atggaggcta tctactacgg caccaacaca gcctggggct atggcgcagg caatggacca       660
     tggatcatgg ccgatctcga gaatggactg ttctccggtc agagctctga ctacaacgcc       720
     ggtgacccga gcatttccta ccgcttcgtc acagcgatcc ttaagggcgg cccgaactta       780
     tgggctcttc gcggtggcaa tgccgcatcc ggctcgctgt cgacgtacta caatggaatt       840
     cgcccaaccg atgcttcagg ctataacccc atgagcaagg agggtgcgat catccttgga       900
     attggcggcg acaacagcgt tagcgcgcag gggaccttct acgagggcgc catgacggac       960
     gggtatccag acgacgcaac ggagaactct gtccaggctg atatcgttgc ggccaaatat      1020
     gctactactt cactcatcag cgggccggcg ttgaccgtcg gtgacacggt ctcattgaag      1080
     gttaccacgt ccggctatga tacgcggtac atcgcccaca ccggcagcac cattaacact      1140
     caggtcgtct cctcctctag ctcgagtacc ctgaagcagc aggctagctg gaccgtccgc      1200
     accgggctgg ccagtactgc ggccgcgaat gggtgcgtta gcttcgagtc cgtcgacacc      1260
     cccggcagct atattcgaca ctcgaatttt gcgcttttgc ttaatgcaaa cgacgggacc      1320
     aagctgttct ctgaggacgc taccttttgt ccccaggaca gtttcaatga cgacgggacc      1380
     aactcgatcc ggtcctggaa ctacccgacc cgctattgga ggcactatga gaacgtgctc      1440
     tatgtggcga gcaatggggg agtcaatact ttcgatgccg ccactgcctt cactgacgat      1500
     gtcagttggg tcgttgctga cggctttgcc tag                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page