(data stored in ACNUC16935 zone)

EMBL: BN001307.PE419

BN001307.PE419       Location/Qualifiers
FT   CDS_pept        complement(join(1161180..1161276,1161381..1161547))
FT                   /locus_tag="ANIA_11308"
FT                   /old_locus_tag="AN11308.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008203"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008203"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008203"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN13"
FT                   /protein_id="CBF85136.1"
FT                   /translation="MTVSPAPSQSYPATSQRYPARYSPQTVTSLTPEMVMFAARWIVSV
FT                   SDSIARAGNRPARRDTLDFYLLDGARLASHKSANYLQAQTRY"
     atgacagtct ctcctgctcc cagtcaatcc tatcctgcta catcccaaag atatcccgca        60
     agatatagtc ctcaaaccgt cacatctctg actccagaaa tggtgatgtt tgctgctaga       120
     tggatcgtgt ccgtctcaga tagcatagct agggcaggaa acaggccggc gcgccgtgat       180
     actcttgact tctaccttct ggatggcgcc agactggcaa gtcataagtc cgcgaactat       240
     cttcaagccc agacgcgtta ttga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page