(data stored in ACNUC16935 zone)

EMBL: BN001307.PE42

BN001307.PE42        Location/Qualifiers
FT   CDS_pept        116117..116443
FT                   /locus_tag="ANIA_09020"
FT                   /old_locus_tag="AN9020.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007833"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007833"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007833"
FT                   /db_xref="GOA:Q5ARR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR0"
FT                   /protein_id="CBF84447.1"
FT                   /translation="MDASDDPQGHQLNELTAQRLQCYQGCAIVRLQNLEFETNPLHGSL
FT                   DFDERKVERLLTIFEIEGCGNLAPEHRVAALINRGTLSKAISQSGITWESLLDPTIQPQ
FT                   LLLE"
     atggatgcgt cggatgatcc tcaaggtcat cagttaaatg aacttactgc ccagagacta        60
     cagtgctacc agggatgtgc catcgttcgc ctgcagaact tggagttcga gacgaaccct       120
     ctgcatggaa gcctggactt cgatgaacgc aaggttgaga gacttctcac tatttttgag       180
     attgaaggtt gcggcaacct tgcgccggaa catagagttg ctgccctaat taaccgaggg       240
     accctgtcaa aagcgatttc gcagtcaggc atcacatggg agtcgctctt agacccaacg       300
     atccaaccac aacttctcct cgaatga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page