(data stored in ACNUC16935 zone)

EMBL: BN001307.PE420

BN001307.PE420       Location/Qualifiers
FT   CDS_pept        join(1162629..1163455,1163530..1163959)
FT                   /locus_tag="ANIA_01572"
FT                   /old_locus_tag="AN1572.4"
FT                   /product="toxin biosynthesis protein (Tri7), putative
FT                   (AFU_orthologue; AFUA_8G05970)"
FT                   /note="transcript_id=CADANIAT00008204"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008204"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008204"
FT                   /db_xref="GOA:Q5BD08"
FT                   /db_xref="InterPro:IPR032805"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD08"
FT                   /protein_id="CBF85138.1"
FT                   /translation="MASRLAIPPWLTPLTSWTLLQTLTSLTVTFTPSASSLRYVAAAMT
FT                   AICAYIFQTSIQNHFSGAPASGPLVAMCWVNVLNAIDLLVLSRASFDAYLSYRRSKEEK
FT                   KDSRRSSTEDSTKDRLLLALTLPYNYRRINTPWQLSRLPVLTPSSFPSSLTVNNRRKFL
FT                   LHSTVKLILAVIIMQIPLIDPSDPVVLQAVSQLDRSKSVLLLPFCAFTQKGGLHALWLQ
FT                   ARFTLAFGIVIRATIVAAYTAGSIFAVMLGGDPAEWPPVAGSLSEAWTLSRLWGQAWHQ
FT                   TLRRPLASNATFLAALAGFAPKSTVAHWIRVLVTFVESGVVHSACDMGFGIPFGESGGV
FT                   VFFSLQILGLVLESVCQSIAAKVGLRTGGRFSRAVGYIWVSVFMLWTAPVWANPILVNL
FT                   ASDGVNLMSPWLGFPAGSF"
     atggcttcaa ggctagctat tccgccatgg ctcaccccac tcaccagctg gacccttctc        60
     cagactctca ccagtctaac agtaacattc acaccgtccg cctcgtctct ccggtatgtg       120
     gccgcggcaa tgaccgctat ttgcgcttac atattccaaa cgagcatcca aaaccacttc       180
     tcaggagcgc ccgcgtcagg cccgctggtt gccatgtgct gggtgaacgt gctcaacgcg       240
     atcgacttgc tggtcctcag tcgggcctcg ttcgacgcct acctctcata taggcgaagt       300
     aaagaggaaa agaaagactc gcggcgctcc agcaccgagg actcgacaaa ggacaggctt       360
     ctcctggctc tgaccctacc ctacaactac cgccgcatca acaccccctg gcaactctcg       420
     cggctgccag tccttacccc ttcttcattc ccgtcttcgc ttacggtcaa taaccggcgg       480
     aagttcctcc tgcactctac cgtgaagctc atcctcgccg tcatcataat gcaaattcca       540
     ctcatcgacc ccagcgatcc cgttgttctg caggcggtct cgcaactcga tcgatcgaaa       600
     tcagttctcc ttctaccctt ttgcgccttt acccagaagg gcgggttgca tgcgctctgg       660
     cttcaagctc gcttcacgct ggcattcgga atcgtcatcc gtgcgaccat tgtcgccgcc       720
     tacacggccg gctctatctt cgctgttatg ctcggcgggg atcccgccga gtggccgcct       780
     gtagcgggaa gtctgagcga ggcgtggaca ttgagccgtt tatggggaca agcatggcac       840
     caaacccttc gccggcctct ggcatcaaac gcaaccttcc tcgcggcact cgctggcttt       900
     gcacccaaga gcaccgtggc gcactggatc cgcgtcctgg ttacctttgt agaatcgggc       960
     gtcgtccact cagcctgtga tatgggcttc ggcatcccct ttggagagag cggaggagtg      1020
     gtgttctttt cccttcagat tctgggactc gtactcgagt ctgtctgtca gagtattgct      1080
     gcaaaggtgg gattgaggac tgggggcaga ttcagtagag cggtcgggta tatctgggtc      1140
     tctgttttca tgctctggac agcgcctgtt tgggctaacc cgattctggt gaatttggcg      1200
     agcgacggag tcaatctgat gagtccttgg ctggggtttc cggccgggag tttttga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page