(data stored in ACNUC16935 zone)

EMBL: BN001307.PE421

BN001307.PE421       Location/Qualifiers
FT   CDS_pept        complement(join(1164128..1165242,1165305..1165629,
FT                   1165682..1165879))
FT                   /locus_tag="ANIA_01573"
FT                   /old_locus_tag="AN1573.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008205"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008205"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008205"
FT                   /db_xref="GOA:Q5BD07"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD07"
FT                   /protein_id="CBF85140.1"
FT                   /translation="MSVLLVFSLVTFALQGLCSLSLHESDSPHVLQLGLRRNQHNDPVG
FT                   RDRRRFKRQTGTVAVDLHGDSMGGDIYSTNLTIGDPPQAVEVSVDTGSADLWVVYSENP
FT                   VCNVRGARCDDSGTYDPTASTSFDGLSDEFAIEYGDSSWAEGYYGIDTLTVADAEVSEV
FT                   QFAVAVESSIDKGILGIGYSTNVVSTYRYPNLPERLVASNITSSNAYSLWLNRLGSDEG
FT                   TILFGGVNTAHYTGPLRTLPVVRYNGHYIHLWLTLTGMGVESASDDITKSYSETRSTTG
FT                   EQEFPFVALLDSGATLTYLPSNIVAQIFSDLDVHLYEPEQFGYVPCDTYLVGREDYNLT
FT                   FTFSGVTIRVPLRELVLRDAISGPGRDALQLPNNADEESCLFGILPNTDLFPILGDTFL
FT                   RSAYVVFDLDNNEISLAQANTAPGDDRILEIGSGDDAVPEAEDVDDPVTTATVSLGGSS
FT                   LILPTGWTNEPIFPSRTVTTSTTATSTGTNTGSGEDTEATDSDQGTSGGTGTQAEGPVA
FT                   TDGAVGVGNSPLLAIAMAALVLNMVLAL"
     atgagtgttc tcctggtttt ctcgctcgtg acttttgcac tgcagggtct atgcagccta        60
     tctcttcatg agagcgactc gcctcacgtc ctccaacttg gactgcggcg aaaccagcac       120
     aatgaccccg tgggacgaga ccggcggcgg ttcaagcggc agactggtac ggtggccgtc       180
     gatctccacg gcgattcgat gggcggcgac atctattcca cgaacctgac catcggcgat       240
     cccccgcaag ctgttgaggt ttctgtcgac acgggcagcg ccgatctctg ggtcgtatac       300
     agcgagaacc cggtctgcaa tgttcgaggg gcgcggtgtg acgactcggg gacgtacgat       360
     cctactgctt cgacctcgtt tgacgggcta tccgacgagt tcgcgatcga gtacggcgat       420
     agttcgtggg cggaggggta ctatgggatc gacaccctga cggtcgcaga tgccgaggtc       480
     tcagaggtgc agttcgccgt tgcggtcgaa tccagcatag acaaggggat cttaggcatc       540
     ggctacagta caaatgtcgt ctcgacctac cgctacccca acctccccga acggcttgtg       600
     gccagcaaca tcacctcttc gaacgcgtac agtctttggc tcaaccggct gggctccgac       660
     gaagggacta tcctcttcgg cggcgtcaac accgcccact acaccggtcc cctgcgaacc       720
     ctccccgtcg tgaggtacaa tggacactac atccacctct ggctcacgct cacggggatg       780
     ggcgtcgagt ccgcctcgga cgatattaca aagtcatact cggaaacgcg gtccaccact       840
     ggggagcagg aattcccctt cgtcgcgctc ctcgactccg gcgcgactct cacgtacctc       900
     ccctcgaaca ttgtcgcaca gatcttttcc gacctcgacg tgcacttgta cgaaccagag       960
     caattcggct acgtaccgtg cgacacatac ctcgttggcc gagaagacta caatctgacg      1020
     ttcacattca gcggcgtgac gatccgcgtt ccactccgtg agcttgtgct gcgggatgcg      1080
     atctccggcc ccggcaggga cgcactccag ctgcccaaca acgccgacga ggaaagctgc      1140
     ctattcggta ttctgccgaa taccgacctc tttcccatac taggcgatac atttctcaga      1200
     agtgcatatg tcgtctttga cttggataac aacgagattt cgcttgctca ggccaatacc      1260
     gcgcccgggg acgaccggat cctcgagatt gggagtggcg acgatgcggt cccggaagca      1320
     gaggatgtgg atgaccccgt cacgactgcg acagtttcgc tcggggggtc gagcctgatt      1380
     ctgccgactg ggtggacgaa tgagcccata ttcccgagta ggactgtgac cacgagcacg      1440
     actgctacaa gtacgggcac aaacacgggt agtggagagg acacagaggc gacggattct      1500
     gaccagggta catctggcgg aactgggaca caagctgaag gccccgtcgc tacagacggc      1560
     gccgttgggg tgggaaatag cccacttctg gccatcgcga tggccgcact tgtcctaaat      1620
     atggtcctag ctctgtga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page