(data stored in ACNUC16935 zone)

EMBL: BN001307.PE422

BN001307.PE422       Location/Qualifiers
FT   CDS_pept        complement(join(1167333..1167622,1167767..1168097))
FT                   /locus_tag="ANIA_01574"
FT                   /old_locus_tag="AN1574.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008206"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008206"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008206"
FT                   /db_xref="GOA:C8VN16"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN16"
FT                   /protein_id="CBF85142.1"
FT                   /translation="MGPEPRPDSRSSHTDTNTSASLRPRPRPRNEAHLDPDNLELHEIE
FT                   TQQDDDSGVSISSGEYRITTRRTVSRTSTSQTQRPRREGLLGRIQRFWTRHVVLTVAQK
FT                   KNRDYFALERTFLAYIRTSVILAMQGVLIAQLFRLQFAGSSKGLGYHEVGVPLSVTCHC
FT                   AAIVTAILGAHRFWKQQSAIALGTVYAGGWELNCIGFLTTAVS"
     atggggccag agccgagacc tgactcacgg tcgtcccaca ccgacaccaa caccagcgcc        60
     agcctgcgac cgcgaccgcg accgcgcaac gaagcccacc tggacccaga caacctggag       120
     ttgcacgaga tcgaaactca gcaggacgac gattcaggcg tgtcgatctc ctctggagaa       180
     taccgcatca ccacgcggcg gacggtatcg cgcacctcga ccagtcagac gcagcggcca       240
     cgacgcgagg ggctcctcgg gcgcattcaa cggttctgga cgaggcatgt ggtcttgaca       300
     gtggcgcaga agaagaatcg ggattatttc gctctcgaac gaacgtttct cgcgtacatc       360
     cggacctccg tgatcctcgc aatgcaaggc gtcctgatcg cccagctgtt ccgccttcag       420
     tttgccggct caagcaaagg cctcggatac catgaagtcg gcgtcccgtt atcggtgacg       480
     tgccattgcg cggccatcgt gacggcgatc ctgggagcgc atcggttctg gaaacagcag       540
     agtgcgatcg cgctggggac ggtatacgca ggaggttggg aactgaactg catcgggttc       600
     ttgacaacgg cggtgagttg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page