(data stored in ACNUC16935 zone)

EMBL: BN001307.PE423

BN001307.PE423       Location/Qualifiers
FT   CDS_pept        complement(join(1169249..1169339,1169631..1169707,
FT                   1169870..1169891,1169990..1170297,1170445..1170539,
FT                   1170725..1170890,1170952..1171082,1171281..1171605,
FT                   1171664..1171789,1171885..1171962))
FT                   /locus_tag="ANIA_01575"
FT                   /old_locus_tag="AN1575.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008207"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008207"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008207"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD05"
FT                   /protein_id="CBF85144.1"
FT                   /translation="MRRPRLPVWETGRQTDREARRLYCFQVSESSRRSATPSSAWARSM
FT                   ISSYSYAWATRTARWQGNERGDAPTGGSSEHRAGADLCIVLISILLLKKTRSRLVSSAV
FT                   SLETVGSESEDRPRQSATSLTIAQAFVGLYLGWSSTSTPKALVQDDVRSRLFPDIEGAT
FT                   GGRKQHRHDQHIHERQQLPWETEYNAYFARFQHAVEMAKQLLTAASSMKPMPTFAVNEA
FT                   LLLLCRWRRYKGIWSSGTAARVLTRVIEIETVGLVPGNSIADFSWIDSVHVDVRCSADC
FT                   CWAKWSIGNAQGQSQTLFYAAPTSAILSYTEPPLSNGHTEPATTSSKVTMASTVMAPTP
FT                   GLPAVSNVLPDISLIRRAYLLNLGGNGFNVAVFASSFPSSLSWHRTKAWSFMIGTACDR
FT                   LLVLGMRHASRLSRSMYMVVQSRLAMTVPQCGRMNIMIAGPPSRSGRRHDLYRGHTAER
FT                   MGPSDIGFQDSGLT"
     atgcgacgac ccaggctgcc cgtctgggag accggacgcc agacagatag agaagcccgg        60
     cgcttgtatt gctttcaggt cagcgagagc agccggcggt ctgccacgcc gtcatcagcc       120
     tgggctcgct caatgatcag ttcttacagc tacgcatggg caacgcggac agcgcgatgg       180
     cagggcaatg aacgcggcga cgcgccgact ggaggctcct cagagcacag agctggtgct       240
     gatttatgca ttgtcctgat ctccatcttg ctcctcaaga agacacgcag tcggctggtt       300
     tcatctgcag tcagccttga aactgttggg agcgaatcgg aggaccggcc ccggcagagc       360
     gcaacgagct tgacaatagc ccaggccttt gtgggactgt atctgggctg gtcatcaacc       420
     agcacgccaa aggcccttgt gcaggatgat gtacggtccc gtttgttccc tgatatcgaa       480
     ggcgccactg gaggccgtaa acaacatcgc cacgaccagc acattcatga gaggcagcag       540
     ctaccatggg agacggagta caatgcatac ttcgcgcgct tccagcatgc cgtggagatg       600
     gcgaagcaac tgctgacggc cgcctcaagc atgaagccga tgccgacgtt cgccgtcaac       660
     gaagcgttgc ttctgctgtg cagatggcgc cgctacaaag gaatctggtc gagcggcacc       720
     gcggctcgtg tcttgacgcg agtgattgag attgaaactg tcggactggt tccgggaaac       780
     agcattgctg atttctcttg gatcgattca gtccatgtcg acgttcgttg ctcggcagac       840
     tgctgctggg ccaagtggag catcggcaat gcgcagggac agtcgcagac actcttttac       900
     gcggctccca ctagtgctat actttcctat acagaaccac ctctttcgaa tgggcacact       960
     gaaccagcta cgacttcatc aaaagtcaca atggcatcga cagtgatggc gcctacacct      1020
     ggattaccag cagtcagcaa tgtactccca gatatctccc ttatccgtcg cgcatacctg      1080
     ctcaacctcg gcggcaacgg cttcaacgtg gccgtcttcg catcctcatt cccatcaagc      1140
     ttatcgtggc atcgcaccaa agcgtggtca ttcatgatcg gtacggcctg cgatcggttg      1200
     ctggtgttgg gtatgcggca cgcatccagg ttgtcgcgtt ccatgtacat ggtagtgcaa      1260
     tcacgacttg caatgacagt tccacagtgc ggtcgaatga acatcatgat cgccgggcct      1320
     ccatcccggt ctggaaggcg ccatgatctc tatcgcggcc ataccgctga gcgcatgggg      1380
     ccatccgaca tcggctttca ggacagtggt ctgacctga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page