(data stored in ACNUC16935 zone)

EMBL: BN001307.PE424

BN001307.PE424       Location/Qualifiers
FT   CDS_pept        join(1174761..1174873,1174929..1175368,1175444..1175565,
FT                   1175606..1176190)
FT                   /locus_tag="ANIA_01576"
FT                   /old_locus_tag="AN1576.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008208"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008208"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008208"
FT                   /db_xref="GOA:C8VN18"
FT                   /db_xref="InterPro:IPR022185"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN18"
FT                   /protein_id="CBF85146.1"
FT                   /translation="MKFADIPGGSGMIISRGTLSAMGFSALSCLPYCSPFCKIIYAVPA
FT                   FTTYLLNESPLPSLQVSLLTPTNDSILFSASSEIKVPDALTMHLDSMHAEIFRPQPRGR
FT                   PKEDLIPLAEVDISKLHFKGNQKITMKNQTLKLGDVGQFARLVEDAAYHSTFRTAMHAK
FT                   TKVGLAGLTTSIDITKEVEMPGFSNFTELAINDLTIRERDDQGNNIFAETVLFNPTPAS
FT                   VTLVMKLTLWDKGDVTLSILAANHSIGTATSSINNIKSGNNTLSIRAFLDGDVLEENIS
FT                   GIIREQIPYLRKGDIKITATGKSVVYNGQHLEYWETALQAVRVEVTRSVREVVNMVLDT
FT                   LDGDDIVGEDGDDSGFGIFGFEIDIPRVQEGVRSVVEGLVEQILDTAKGLDENEEDTFT
FT                   EELTVLGRLILRLLQVLGVL"
     atgaaatttg ctgatattcc agggggttcg ggaatgatca tttcgcgcgg tactttatct        60
     gctatgggat tctcggcgct gtcctgcttg ccatactgct ccccattctg caaaatcata       120
     tacgccgtcc cggccttcac aacctacctc ctcaacgaga gccccctgcc ttccctgcaa       180
     gtctctctcc ttacccctac gaacgacagc atcctgttct ccgcctccag tgagatcaaa       240
     gtccctgacg cgctgaccat gcatcttgac tcgatgcatg cagagatctt ccggccgcaa       300
     cccagaggga gacccaagga ggacctgata ccgcttgcag aggttgacat ctccaagcta       360
     cacttcaagg gaaaccagaa gatcactatg aagaatcaga cgctgaaact cggggacgtg       420
     ggccagttcg caagattagt tgaggatgcc gcgtaccact cgacgttccg gactgcgatg       480
     cacgcgaaga ccaaggtcgg gctggcaggg ctgacgacga gtattgatat aacgaaggaa       540
     gtagagatgc ctggcttcag caatttcact gaacttgcaa ttaacgacct cacaatcaga       600
     gaacgcgacg accagggcaa caacatattc gccgagactg tcctcttcaa tccaactcca       660
     gcatcagtca cgcttgtgat gaaactgaca ttatgggata agggcgacgt gaccctctcc       720
     atcttggccg ccaaccactc catcggcacg gcgacgagca gcatcaacaa tatcaagtcc       780
     gggaacaata ccctgagcat ccgtgcattc ctcgatggtg acgtattgga agagaacatt       840
     tctggaatta ttagagagca gattccgtac cttcggaagg gggatattaa gatcacagca       900
     actggcaagt cagtggtgta taacgggcag catctcgaat actgggaaac agcgctgcag       960
     gccgtcagag tcgaggtgac gaggtcggtg agggaggtgg tgaatatggt ccttgatacg      1020
     cttgacgggg atgacattgt aggtgaagat ggagatgatt ctggctttgg aatcttcggg      1080
     tttgaaattg atattcccag agtccaagag ggcgtaagat ctgttgttga ggggcttgtt      1140
     gagcagatct tggatactgc taaagggctg gatgagaatg aggaagacac atttacggag      1200
     gaattgactg ttcttgggag gctgatattg cgattgctgc aggttcttgg ggttctgtag      1260
//

If you have problems or comments...

PBIL Back to PBIL home page