(data stored in ACNUC16935 zone)

EMBL: BN001307.PE426

BN001307.PE426       Location/Qualifiers
FT   CDS_pept        complement(join(1183487..1186068,1186218..1186281))
FT                   /locus_tag="ANIA_01578"
FT                   /old_locus_tag="AN1578.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008210"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008210"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008210"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD02"
FT                   /protein_id="CBF85149.1"
FT                   /translation="MFWALTDTKYAGKRRYSTGQAFAKMLPQFLQGSYARYKADTNIFA
FT                   TWLLEAANQCGYQPSSLFASVPTAKKSQQKGKNNASDAEPLHYRATIKDLQKLAEVIAS
FT                   SALTVPEPVLTIAKRAIRLRKVVTSWFLGHGDTTSNERHAHFITVLERICETLEWKSSQ
FT                   STRPDINHPLPTPEAQSDDANVDGFLNRFAVLTVEEPQDTEEAQATPVGSKKVVKVTVV
FT                   EDNNEAEDSYFGLLFFKTLCLLRDLENMRRFISITWSEYRDKKIDLMNAAIVTDSALQL
FT                   ARELVEEVEADWHTSLTGKEDNVQNIVYNYAVLTRGSSAAPSREIGLPYNKNMADIAEW
FT                   CYVPTMVVLESFAKVLQVNHQPVFKKGSFGTYDPKMDRERMSLGQKFNEDQTILFSILP
FT                   EFCMVNRFGIQMPVQDAVTRGVVEFIKTKKVTLWLCFASQIFLDVHHTMRHSTLGAFED
FT                   LRMSGLRIQKTIDDYLQLSKTHPQPRFWPKEGDEEIRNISSTVQSWIIQDRFLDIRVQT
FT                   KLDRIGPPPEKHALFSQHAILCGLILFHLNTRMQFVGQQLLNQWYDVQQLAFLHNLVIK
FT                   SPAHKNLRWPDMDAFIKIHGESHIFIGSRPGDAVESLKRLELVTGISSVANFARDSRSR
FT                   RFHNPNGKHARSLKPTTTVANLFFTKYVEGTEEGAGIVDFDRVLDELSQKSKLGASTEG
FT                   IQRADPQSIITRKWSNTHNIDTLQLLAFLKAKLFEEEPIILYNYFGMHKRSVELLRLIR
FT                   DKEHQKFVQYFTSVYLPDESFISNIVILIHHVVQGSAQNARAMGLASGGVEVGSRILIS
FT                   AGDVMREYLKKNGDLACKELRVFCKNKKPIQDDAYDESESDELVHSWLSLEDVLGPKGV
FT                   ASLMTGIQIA"
     atgttttggg ccctgaccga taccaaatac gcaggaaagc gccggtattc tactggacaa        60
     gcgttcgcca agatgttacc tcaattcttg cagggaagtt acgcccgcta caaagcagat       120
     acaaacatat ttgcaacatg gctactggag gcagctaacc aatgtggcta tcaaccatct       180
     tccctctttg ctagtgttcc tacggcgaaa aagagtcaac agaaaggcaa aaacaatgcc       240
     tcagatgcag aaccacttca ttatcgtgcg actatcaaag atttgcagaa gctggccgag       300
     gtgatcgcca gttctgctct cacagtgccc gagccggttc tcacgatcgc gaaacgcgcc       360
     atcagactta gaaaagttgt cacttcctgg ttcctgggcc acggcgacac cacgagcaac       420
     gagcggcatg ctcatttcat cactgtgctg gagcggatct gtgagacgct agaatggaag       480
     tccagtcagt ccacgaggcc agacattaat cacccattgc cgacacctga ggctcaaagt       540
     gacgacgcca atgttgacgg gtttcttaat agattcgctg ttctcacggt ggaggaaccc       600
     caggatactg aggaagctca agcgacaccg gtgggatcga agaaggtcgt taaagtgact       660
     gttgttgaag acaacaatga ggcagaagac tcatactttg gtctattgtt cttcaagacc       720
     ctctgcctac ttcgagactt ggaaaatatg cgaagattca tttccatcac ctggtcggag       780
     tatcgagata agaaaatcga cctgatgaac gctgctatcg tgacggacag tgctttacaa       840
     cttgcccgag aacttgtgga ggaagtggag gctgactggc acacttctct tacgggaaaa       900
     gaggataatg tgcagaatat tgtctacaat tacgctgttc ttacccgcgg cagttctgcg       960
     gctccatcta gggaaatcgg tctgccgtac aacaaaaaca tggccgatat agccgagtgg      1020
     tgctatgtgc caaccatggt tgtgcttgag tccttcgcaa aagttctcca ggtcaatcat      1080
     cagcctgtct tcaaaaaggg ctccttcggc acttatgatc ctaaaatgga cagagagcgg      1140
     atgtccttgg gccagaaatt caacgaagat caaacgatcc ttttttcgat tctgccagaa      1200
     ttctgcatgg tcaataggtt cggaatccag atgcctgttc aggacgcggt cactcgaggc      1260
     gttgttgagt ttatcaagac taaaaaggtt actttgtggc tttgcttcgc ctcccagatc      1320
     tttctggacg ttcatcatac tatgcggcac agtacactgg gtgcttttga agacctccga      1380
     atgtcgggac ttcgcatcca gaagactatc gatgactacc tgcaactgtc gaaaacgcat      1440
     cctcagccga gattctggcc aaaagagggt gacgaggaga ttcggaatat cagttcaacc      1500
     gtgcaatcat ggatcataca agatcggttt cttgatattc gagtccagac taaactcgac      1560
     agaattgggc ccccgcctga aaagcatgca cttttctcgc agcacgctat tctctgcggc      1620
     ttaattctat ttcacctcaa tacccgaatg cagtttgttg gtcagcagct ccttaatcaa      1680
     tggtacgacg ttcaacaatt ggccttcctg cacaaccttg tcattaagtc tccagcgcat      1740
     aaaaacctga ggtggcctga tatggatgct ttcatcaaga tccatggcga atctcacatt      1800
     ttcattggtt cgcggccagg ggacgccgtt gaatcgctga agcggcttga gttggtcact      1860
     ggcatctctt ctgttgccaa ttttgcccga gattccagga gcagaagatt tcataacccc      1920
     aatggcaagc atgcccgctc gctcaagccg accaccacag tcgcgaacct gtttttcacc      1980
     aagtatgttg agggtaccga ggaaggtgct ggaattgtag actttgacag ggtcctggac      2040
     gaactttcgc agaaatcgaa gcttggagca tcaactgagg gcattcagag agccgatccg      2100
     caatccatca tcacccgaaa gtggtctaat acccacaata ttgacacact acagcttctt      2160
     gccttcctga aggccaagct attcgaagaa gagcctatca ttctgtacaa ctacttcggc      2220
     atgcacaaac gctctgtcga gttacttaga ctaatacgag acaaagagca ccagaagttc      2280
     gtccaatatt tcacgtcggt gtatcttcct gatgagagtt tcatttcgaa cattgtcatc      2340
     ctgattcacc acgttgtaca aggctcagcc cagaacgcac gtgcaatggg gcttgcatct      2400
     ggcggagttg aggtgggaag ccgcattctc ataagcgctg gcgacgtgat gcgggaatac      2460
     ctaaagaaga atggggattt ggcatgcaaa gagctgagag tgttctgcaa gaacaaaaag      2520
     ccgattcaag atgatgctta tgatgagagc gaatcggatg aactggtgca ttcttggctc      2580
     agtctggagg acgtcctggg tcccaagggt gtagcctcgc tcatgaccgg gatccagata      2640
     gcgtag                                                                 2646
//

If you have problems or comments...

PBIL Back to PBIL home page