(data stored in ACNUC16935 zone)

EMBL: BN001307.PE427

BN001307.PE427       Location/Qualifiers
FT   CDS_pept        join(1188333..1188547,1188590..1188781,1188850..1189005,
FT                   1189064..1189231,1189304..1189354,1189492..1189891)
FT                   /locus_tag="ANIA_01579"
FT                   /old_locus_tag="AN1579.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008211"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008211"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008211"
FT                   /db_xref="GOA:C8VN21"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN21"
FT                   /protein_id="CBF85151.1"
FT                   /translation="MAQVCTPESLYGYDHAYKIADQSTLDTIASECTSINGSIYIMSNY
FT                   TGPFYLPNIRNISGDVHWYADTSYLYDSISFPDLEHINGSLDLQAGYNLRNISAPKLNL
FT                   VGRLVQVDYAHDVDLRSLQHAEYASIFGNLSSLRLDSLQSINRTLKICNKDSCSSSLSP
FT                   VTSLELYLLSLESSTYIELEGRISTLVVPELTSVVGLETSPALQSSEGFQLTTAGGPPL
FT                   NLVFPRLDTVYGRFQVSGNIASLSMPKMIDTNMTLEVNAVNLPSLRRASDGIYIYSDMA
FT                   LDCDAIEEEIFRNVSISNGSKTCSAKEAEPESHGLSTGDKAGIGIGSGFAGIIIFVLIP
FT                   LYIRHRKKEKERLKAVSEVELMPPSYQAAQQDRASLPEYSPGEHRPVASPRGT"
     atggcccagg tttgcacccc agagtcatta tatggttatg atcatgccta caaaatcgcc        60
     gatcaatcca ctcttgatac tatagccagc gaatgtacaa gtataaatgg tagcatttat       120
     atcatgagca actacaccgg tcctttctac ttacccaata tccggaacat cagcggtgat       180
     gttcattggt acgcagacac ttcgtaccta tatgactcaa tctcgtttcc agatctcgag       240
     cacataaatg gcagcctgga tctccaggct ggatataatc tgagaaacat ttcggcgccg       300
     aaattgaatt tggtcggtcg tttggttcaa gtggactacg cccacgatgt ggatttgagg       360
     tcactccagc atgcagagta tgcgtctatc tttggaaatc tttcgagctt gcgacttgac       420
     tcattacaat cgatcaatcg gactctgaag atctgtaata aggacagctg cagtagcagc       480
     ctatcgccag tgacgtcttt agagctatat cttttgtcgc tcgaatcgtc aacctatata       540
     gagctggaag gaaggatatc aactttagtt gtaccggagt taaccagcgt tgtaggcttg       600
     gaaacttcac cagcgttgca atcatctgag gggtttcaat tgacgacggc cggtggacca       660
     ccgctcaacc tggtattccc tcgccttgac actgtctatg gacgcttcca agtaagcggt       720
     aatattgcga gcctctccat gcctaagatg atcgacacaa acatgacatt agaagtaaac       780
     gccgtcaatc tacccagtct gcgccgggct tctgacggca tatacatcta ctccgacatg       840
     gcccttgact gcgatgcaat agaagaagaa atatttcgta acgtaagcat atctaacggc       900
     tcgaagacct gctctgccaa agaggcagaa ccagaatcac atggtctcag cactggagac       960
     aaggctggta ttggtattgg aagcgggttt gccggcataa taattttcgt ccttataccg      1020
     ctttatatcc gccatcggaa aaaggagaaa gaacgtctta aggctgtttc tgaggttgaa      1080
     ctaatgccgc cgagctatca ggctgctcaa caggaccggg catctctgcc tgagtattcg      1140
     ccgggtgagc atagacctgt cgccagtcca cgcgggacgt ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page