(data stored in ACNUC16935 zone)

EMBL: BN001307.PE428

BN001307.PE428       Location/Qualifiers
FT   CDS_pept        complement(join(1191996..1192949,1193020..1193807,
FT                   1193889..1195533))
FT                   /locus_tag="ANIA_01580"
FT                   /old_locus_tag="AN1580.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008212"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008212"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008212"
FT                   /db_xref="GOA:Q5BD00"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD00"
FT                   /protein_id="CBF85153.1"
FT                   /translation="MTSLTRDEYTFAWICALPLEMAAARAMLDKIHSPLPKQSADPNAY
FT                   EVGELNGHYIVIACLPAGVYGTVSAATVVSRMRLTFPRLQYGLMVGIGGGVPGRNNDIR
FT                   LGDVVVSKPVGKYSGVLQYDYGKAVQGGIFEPTGTLNKPPHAFLTHMGQLEAKQMTEGK
FT                   AALSKIVREALEKNPEMTEKFAPPEHYTDRLFHSSYHHIPGEDTCERCDVKQLIKRQPR
FT                   ETRSPYVHYGLIASGDQVMKDSETRDRLARQHGILCFEMEAAGLMDELPTLVIRGICDY
FT                   CDSHKQKQWQSYAALTAAAYAKLLLSIMPVCRTCRTESNASERNLLRHWMVSLERNPRF
FT                   VGRQDELSQLEKLLTAPDGPKRVAITGLGGVGKTQLALEVAHRIRNQDRECSVFWVPCT
FT                   SYAMIEQTFMNIAHMLGLHEVKPAEVKERVKLYLSSQRAGKWLLIFDNADDADMWLTTT
FT                   PALEEILPKSEQGRILFTTRNGELAVELTSSNIIHIPDLDKKTAHDMLDRLVLQKNLLQ
FT                   DPVTTSSFLEQLAYFPLAISQASAYINKKRLRRYNDIQNPVITTWLISFKQIQQQDQLA
FT                   ADYLSFMACLDPRNIPSSLLPNQSTDKQKLDALGLLNAYSFTQCQGTQISMHRLVHIAI
FT                   RNWLRKNGLFSLWIQRVADHLEKLFPNSSHHNRGLWRGYLPHALALVHENEFILQLGQY
FT                   TELFERISGCLTRDGRYSEAEVLYSKLMTINQEKNSYEHPDTLRSMANLASTYWNQGRW
FT                   NEAEKLGLQVLETRKAVLGPEHPDTLSSMANLASTYWNQGRWNEAEKLELQVLETSKAG
FT                   RWNEAEKLGLQVLETRKAVLGPEHPDTLSSMANLASTYWNQGRWNEAEKLGLQVLETRK
FT                   AVLGPEHPDTLSSMANLASTYWNQGRWNEAEKLELQVLETSKAVLGPEHPDTLTSMANL
FT                   ASTYRNQGRWNDAEKLDVQVLETRKAVLGPEHPDTLTSMANLASTYWNQGRWNEAEKLD
FT                   VQVLETRKAVLGPEHLHTLSSMANLASTYWNQGRWNEAEKLEVQVLETRKAVLGPEHPD
FT                   TLSSMHNLAYTYHSMGRNTEASDLMTQCATLRARNIGSTHPDTLSSSDALTEWQKLDHH
FT                   RSSKPGKGRKLKALGRVLGFK"
     atgacctctt taacgcgcga cgaatacacg tttgcgtgga tatgcgcctt gccgctggag        60
     atggcagcag cccgtgccat gctggataaa atccacagtc ccctgcccaa acaatccgcc       120
     gatccaaatg cctacgaagt tggcgaattg aacggtcact atattgtcat tgcatgccta       180
     ccagccggcg tatacggaac agtctctgct gcaaccgttg tgtcgcgcat gcgtctaacg       240
     tttccccggc ttcaatatgg gctgatggtt ggaattggag gcggggttcc gggcagaaat       300
     aatgatattc gattaggcga tgtggtggtc agcaagccag ttggaaaata tagcggagta       360
     ttacagtatg attatggcaa ggcagtccag ggcgggatat tcgagccaac aggcaccttg       420
     aacaaaccac cacacgcttt cttgacccat atgggtcagc ttgaggcaaa gcaaatgacc       480
     gagggcaagg ctgcgctttc gaaaatagtg cgagaagccc tagaaaagaa ccctgaaatg       540
     acagaaaaat tcgcgccccc agaacactac acagatcgtt tattccactc ctcctaccat       600
     catatccctg gggaagacac gtgtgaaaga tgcgatgtta aacaattgat taaacgccaa       660
     ccacgtgaaa ctaggtcacc atatgttcac tacggactga ttgcatctgg ggaccaggtg       720
     atgaaggact cagaaacacg cgaccgtcta gctagacaac atgggatact ctgctttgag       780
     atggaggcag caggccttat ggacgaacta cccacacttg taatccgggg gatatgcgac       840
     tattgcgatt cccataaaca gaaacaatgg cagagttatg cagctttaac agcagctgcc       900
     tatgcaaaac tcttattatc aatcatgcct gtttgccgaa catgtcgaac agaatccaat       960
     gcatcggagc gcaatctatt gcggcactgg atggtctcgc tagaacgaaa tccaagattc      1020
     gttggtcgcc aggatgaatt gtcacagtta gagaaactgc tcacagcacc agatggacct      1080
     aagagggttg caattaccgg tttagggggt gttggaaaga cgcaattagc cttagaggtg      1140
     gcacatcgca tacggaacca agacagggag tgctcggttt tctgggtccc ctgtactagc      1200
     tatgcaatga ttgagcagac attcatgaat attgcacata tgcttggact tcatgaagtg      1260
     aaaccagcag aggtgaaaga acgggttaag ctgtacctga gctctcagcg ggcaggaaag      1320
     tggctgctaa tttttgataa cgcggatgat gcagatatgt ggttaacaac taccccagcc      1380
     cttgaagaga tccttcccaa gagcgaacag ggccgcattc tcttcaccac ccgcaatggg      1440
     gaacttgcgg tggagctcac gtcatcaaat attattcata tcccagatct ggacaagaaa      1500
     acagctcatg atatgctgga caggctagta ttacaaaaga acctgctcca ggaccctgtc      1560
     accacaagtt ctttcctgga acagctggca tacttcccat tggcaatttc tcaggcatca      1620
     gcatacatca ataaaaagcg tctaagacga tataacgata ttcagaaccc tgtcattact      1680
     acctggttaa tatcattcaa acaaattcag cagcaagatc agttagcagc agactatcta      1740
     tctttcatgg cctgcctcga cccacgaaac atcccctcat cacttctgcc taaccaatca      1800
     actgataaac agaaacttga cgccttaggc cttctaaatg cgtactcatt tactcaatgc      1860
     cagggcacac aaataagcat gcacaggctt gtgcatattg cgatacggaa ctggctgaga      1920
     aagaatgggc ttttcagcct ctggatccag agggtggctg atcacctgga gaaactcttt      1980
     ccgaacagta gccatcataa ccgggggctg tggcgaggat acctccccca tgcattagca      2040
     cttgtgcatg aaaatgagtt tattctacaa ctaggacagt atacagaatt gtttgagaga      2100
     atatcaggtt gccttacaag agatggaagg tattccgagg cagaggtact atacagcaag      2160
     ctcatgacga taaaccagga gaaaaatagc tatgagcacc cggacactct cagaagcatg      2220
     gcaaatctgg catcaaccta ctggaatcag ggccgatgga acgaagctga gaagttgggg      2280
     ttgcaggtcc tggagacaag gaaggcagta ctgggtcctg agcatccaga tactctcagc      2340
     agcatggcaa atctggcatc aacctactgg aatcagggcc gatggaacga agctgagaag      2400
     ttggagttgc aggtcctgga gacaagcaag gcaggccgat ggaacgaagc tgagaagttg      2460
     gggttgcagg tcctggagac aaggaaggca gtactgggtc ctgagcatcc agatactctc      2520
     agcagcatgg caaatctggc atcaacctac tggaatcagg gccgatggaa cgaagctgag      2580
     aagttggggt tgcaggtcct ggagacaagg aaggcagtac tgggtcctga gcatccagat      2640
     actctcagca gcatggcaaa tctggcatca acctactgga atcagggccg atggaacgaa      2700
     gctgagaagt tggagttgca ggtcctggag acaagcaagg cagtactggg tcctgagcat      2760
     ccagataccc tgaccagcat ggcaaatctg gcatcaacct accggaatca gggccgatgg      2820
     aatgatgctg agaagcttga tgtgcaggtc ctggagacaa ggaaggcagt actgggtcct      2880
     gagcatccag ataccctgac cagcatggca aatctggcat caacctactg gaatcagggc      2940
     cgatggaacg aagctgagaa gcttgatgtg caggtcctgg agacaaggaa ggcagtactg      3000
     ggtcctgagc atctacatac tctcagcagc atggcaaatc tggcatcaac ctactggaat      3060
     cagggccgat ggaacgaagc tgagaagttg gaggtgcagg tcctggagac aaggaaggca      3120
     gtactgggtc ctgagcatcc agatactctc agcagcatgc ataatcttgc ctatacatac      3180
     cattcgatgg gtagaaacac tgaagcctca gatttaatga cacagtgcgc tacgcttcgt      3240
     gccagaaata taggctctac ccaccctgat acattgtctt ccagcgatgc tcttacggaa      3300
     tggcaaaagc tggaccatca tagatcatca aagccaggca aaggccgaaa actaaaggcc      3360
     ttggggcgtg ttctcggttt taagtag                                          3387
//

If you have problems or comments...

PBIL Back to PBIL home page