(data stored in ACNUC16935 zone)

EMBL: BN001307.PE43

BN001307.PE43        Location/Qualifiers
FT   CDS_pept        join(118142..118560,118961..118997,119133..119381)
FT                   /locus_tag="ANIA_09019"
FT                   /old_locus_tag="AN9019.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007834"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007834"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007834"
FT                   /db_xref="GOA:Q5ARR1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR1"
FT                   /protein_id="CBF84449.1"
FT                   /translation="MDPHPSGNLDPPPPLAADFEDPSCNYPLERKHYLYGHRKIPEILR
FT                   MWYQSSREVIIIFLFESRIYYKFNRAGGFNLRSTLQDLSREHIFLIINDFGIRVPDTHK
FT                   AYDEALKERLLLVARRDNPGRRKDDVGQISVDKLRECFKLSQYEELGAPQAEWVCGRWG
FT                   GESTIGLPKRCRTPIATAYSHRGEPKMRRRWLCTPGDAIGREIFKRMGKLSSSIVFLSR
FT                   HQKRSQWPKNVD"
     atggaccctc acccgagtgg aaacctcgac cctccacctc ctctagccgc ggattttgaa        60
     gatccatctt gcaactaccc actagaaaga aaacactatc tatacggcca tcgaaagatc       120
     cccgaaattc tcaggatgtg gtaccaatcg tcaagagaag tgatcatcat tttccttttc       180
     gaatctcgga tctactataa gttcaacagg gccggcggat tcaatctgcg atcaacattg       240
     caggacctct ctcgggagca catcttccta atcatcaatg atttcggcat tagggtacca       300
     gatacacata aggcttatga tgaggcactg aaggagcgtt tgttgcttgt tgcccgaagg       360
     gataacccag gtcgacgaaa agatgacgtt gggcaaatat ccgttgacaa gctccgggag       420
     tgctttaaat tgagccagta cgaggaacta ggcgcacccc aggcagaatg ggtgtgcggg       480
     aggtggggag gtgaatcgac cattggattg ccaaaaaggt gtcgcacgcc cattgccacg       540
     gcctattccc accgtggcga gcccaaaatg cgccgcagat ggttgtgtac gcctggtgat       600
     gctatcggca gagagatctt caaaagaatg gggaagcttt cttctagcat cgtcttccta       660
     tccagacacc agaaaagatc acaatggccg aaaaacgtcg attga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page