(data stored in ACNUC16935 zone)

EMBL: BN001307.PE431

BN001307.PE431       Location/Qualifiers
FT   CDS_pept        1200259..1201644
FT                   /locus_tag="ANIA_01582"
FT                   /old_locus_tag="AN1582.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008215"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008215"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008215"
FT                   /db_xref="GOA:Q5BCZ8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ8"
FT                   /protein_id="CBF85159.1"
FT                   /translation="MVTIKKPQPFKRALHFSEGEFEERRYRALELMKREQLDGFLITKQ
FT                   ETLYYLTGYDTFGYVFFQAMYFHIDGSMKLITRMPDLRQALYTSILKPEDIMIRSDDAS
FT                   SNPVSLVPRVLKQFGINSPNRRIGYEPNSATLTHEIGKLLEEAVDGLCTLVNHSTLFTR
FT                   ELRIVKSPTELRKIRKAAYLADFALIRALKLAKPGAYEGDLWREIVGTVYEGGGDDPAN
FT                   ENILVSGNKAVLTRYSAGKSKIDRQITLEHAGVYKHYHACLMRTIHIGGVTKLAREMFR
FT                   VNILQMEAAMAALKPGREIGDVFEAYARVADKNGFQDQRFNACGYSLGATFAPTWMDYP
FT                   MFVRGQKVIARPGMVFFIHIILMDKATDTASSIGQTVEVTQDGCVALSKLPFCITRKQT
FT                   IAAWKKVKKEDYGFTEEEEDEGENLQDVELSEGDVDAEDYDVEYDFSDYQPSAPPGDPT
FT                   QQA"
     atggtcacta tcaagaagcc gcagccgttc aagcgggccc tgcacttctc ggagggagag        60
     ttcgaggagc ggcgctaccg ggccctcgag ctcatgaagc gcgagcagct ggatggtttc       120
     ctgatcacca agcaggaaac cctctactat ctcacgggat atgacacatt cggatacgtc       180
     ttcttccaag ccatgtactt tcatatcgat ggttcgatga aactcatcac acgcatgcca       240
     gatcttcgcc aagccctcta cacctccatc ctcaaacccg aggacatcat gatccgatcg       300
     gacgatgcga gcagcaaccc agtctccttg gttccgcgcg tcctgaagca gtttggcatc       360
     aacagcccca atcgccgtat tgggtacgag cctaattcgg ccaccctgac tcacgagatc       420
     ggcaaattac tggaagaggc cgtagatggg ctctgtactc tggttaacca cagcacgttg       480
     tttacgcgag aactgcgcat tgtcaagtcc ccgactgaac tgcgcaagat ccgcaaggcc       540
     gcctatttgg ccgattttgc cctcatccgc gcactcaaat tggcgaaacc aggagcgtac       600
     gagggcgatt tatggcgaga gattgtggga acagtctacg agggcggcgg cgacgaccca       660
     gcaaacgaga acatcctcgt ctccggaaac aaggcagtcc tcacccgtta ttcggctgga       720
     aagtccaaga tcgaccgaca gattaccctc gaacacgcgg gcgtgtataa gcattaccat       780
     gcctgcctta tgcgtacaat ccatatcggc ggcgtcacca agctcgcccg ggagatgttt       840
     cgagtcaata tcctgcagat ggaagcagcc atggctgccc taaaacctgg tcgcgagata       900
     ggagatgtct tcgaagccta tgctcgagtt gccgacaaga atggcttcca ggaccaacgg       960
     tttaacgcgt gtggatatag cctgggcgcc acatttgccc cgacctggat ggactatccc      1020
     atgtttgtgc ggggccagaa ggtcattgcc cggccgggca tggtgttttt catccatatc      1080
     atcctaatgg acaaagcgac tgatacagca agctcgatcg gtcaaacggt cgaggtgacc      1140
     caggacgggt gtgttgctct ctctaagctc cccttctgta tcacgcggaa gcagacaatt      1200
     gctgcctgga agaaagtaaa aaaggaggac tatggtttca cggaagaaga ggaagacgaa      1260
     ggtgaaaatc tgcaggatgt ggaactctct gagggcgatg tggatgctga agactatgat      1320
     gttgagtatg actttagtga ctatcagcct tctgctcccc ctggagaccc tacccagcaa      1380
     gcttag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page