(data stored in ACNUC16935 zone)

EMBL: BN001307.PE436

BN001307.PE436       Location/Qualifiers
FT   CDS_pept        complement(join(1212255..1212799,1212877..1213867))
FT                   /locus_tag="ANIA_01587"
FT                   /old_locus_tag="AN1587.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008220"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008220"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008220"
FT                   /db_xref="GOA:Q5BCZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ3"
FT                   /protein_id="CBF85168.1"
FT                   /translation="MAQPMSGDVPELAPLEVVVPTRRRRMIGWAMLQPGEKVEPSQRFD
FT                   SNITQEHILPPDQKRRRPAVQESEPQHKGHSNAKTKGNMPSKRSSQGSRAPQQSRILLG
FT                   ETKPGADDSIELKREITRLKIENDLRALAESREIQRLQAEVKRLGRLKTELNRAIDRLL
FT                   SDPTRSAAATPESATSNDAILREKERLIERQICSINDLESSLSEAYEHEFLRSRIRNTD
FT                   LPTSTASIEDAMILIKRGVIRTADLLSSCLHPPDLLHLVLQMNAATDLRNLFNSTVKDS
FT                   SILEKTPDLALRAMLFRIVRDQILNSEIWTAFHTEGFMLRAYQRTIQQTAGSEFASTFH
FT                   KASLLYMLDHDPDFEACFLGAQVKELQIYTMRLLDPFFDSAKLTPNEKDLLREMDHLFF
FT                   ETFFFRARCFAPDGIRYEVIHFEPGESFDSVTMEAQDAPQEQLQGQERDKKPLIRLCVH
FT                   GTVVAHRIYETETEGLRKLKLLSQPFLQPSKSRAHSGRAVGEVVSDKAIVVLR"
     atggcacaac ctatgtctgg agacgtccct gagctggccc cgctagaagt ggtcgttcca        60
     acccgcaggc gccgtatgat agggtgggct atgctgcaac cgggtgagaa agtagagccg       120
     tcgcagcggt ttgactccaa cattacgcaa gagcatatcc tcccgccaga tcagaagcga       180
     cgtcggccag ctgttcaaga gtcagaaccc cagcataaag ggcactctaa tgcgaagaca       240
     aagggaaaca tgccctcgaa gcggtcatct caaggaagcc gagcacccca gcaatctcgt       300
     atattgttgg gggaaacaaa gcccggcgcc gacgattcca tcgagctcaa gcgagagata       360
     acgcgcttga aaattgagaa cgatctccgt gctcttgcag agtctcgaga gattcaacgg       420
     ctccaagctg aggtgaagcg cttgggaagg ctcaagacag aattgaacag agcgattgac       480
     cggttgttat cagaccctac ccgttctgca gcagcaacgc ccgaaagtgc tacaagcaac       540
     gatgctatat tgcgcgagaa ggaaaggttg atcgaacgcc agatttgctc gattaatgac       600
     ctggaatcaa gcttgagtga ggcttatgag catgaattcc tacgttcgag gattcgaaat       660
     acggaccttc caacaagcac agctagcatc gaagatgcta tgatattaat caaacgtggt       720
     gttattcgta ctgcagattt actgtccagc tgtttacacc ctcccgattt actacatctt       780
     gtacttcaga tgaatgcagc caccgatctt cggaatttgt tcaacagcac agttaaagac       840
     agcagcattc ttgaaaaaac ccctgactta gctctgcggg caatgttatt ccgtattgtc       900
     cgtgaccaaa tactaaactc cgaaatttgg acggctttcc acacagaagg gttcatgctg       960
     agagcctatc agaggacgat tcagcaaact gccggtagcg agtttgcctc gacatttcac      1020
     aaagcatctc tgctttacat gttggaccac gacccagatt tcgaggcatg tttcctcggt      1080
     gcacaggtga aagaacttca gatttataca atgaggctgt tggatccatt cttcgattct      1140
     gccaagctga caccaaacga aaaagacctt ctccgtgaga tggaccacct cttttttgaa      1200
     acctttttct tcagagcccg gtgttttgct ccggacggca tacgatacga ggtcatccac      1260
     ttcgagccag gagagtcctt tgattcagtt accatggagg cgcaggacgc gccgcaggag      1320
     caattacagg gccaggaacg ggacaaaaag ccgctaatca ggctttgtgt gcatggaacg      1380
     gtcgtggcac ataggattta tgaaacagaa acagaggggc tgcgtaagct taaactactg      1440
     agccaaccgt tcttgcaacc atccaagtct cgagcccata gcggaagagc cgttggggaa      1500
     gtggttagcg ataaagcaat tgtggtgctt cggtga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page