(data stored in ACNUC16935 zone)

EMBL: BN001307.PE437

BN001307.PE437       Location/Qualifiers
FT   CDS_pept        join(1214303..1214842,1214891..1215259,1215312..1215356,
FT                   1215413..1215479,1215529..1215790,1215897..1215966,
FT                   1216044..1216144,1216192..1216369,1216458..1216608,
FT                   1216689..1216918)
FT                   /locus_tag="ANIA_01588"
FT                   /old_locus_tag="AN1588.4"
FT                   /product="HSP70 family protein (AFU_orthologue;
FT                   AFUA_3G13740)"
FT                   /note="transcript_id=CADANIAT00008221"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008221"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008221"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ2"
FT                   /protein_id="CBF85170.1"
FT                   /translation="MADLRRLATRKRRRASTIVDQNVCFTGTDTEDGDSMVPETPPSRS
FT                   WSRSQSRGSSRSTWTNQATTETGTETSAIPSTETSVEPSVELTEPFTSRSTSAQSDTLS
FT                   PRTKFIIGLDYGTTFSSVSYIKFDSARPPPTLFGAQICSITDWPGVDSRARNIPEVPSE
FT                   SWYLGDRFYWGYGARQGYAKLLLPGNQKETRGPREELRRTLVRARKDETEAIKDYLRQI
FT                   LKYSKEFLTEREELSEECEVELVFCVPAGWPAKAIRTMQEILLDIAHELNIGTLATPFV
FT                   LNEPEAAAAYILEACSGRKRLSTGEVFMVCDAGGGTVDAITYRVCQQHPFRVEEVVPPT
FT                   GSNCGSSYANQTLKHQAIEKIKSTAYESLKGPSFEYIIEHDIMTEFEYKIKRGFNPADG
FT                   LDGDEVIVVHGLERNERLGFGHNTMRIKSLNGISKLIRQQISAAAAKGLTVETILLVGG
FT                   FSAAPILRSHIETEFEALKIIYPPKGLDSAVTVSHGAVFRAFNKSDGPKRIVQSNFGFL
FT                   QLELYSTRQPAHRGVSPIFNAIDGKKYGLVLSKQQQFRTRNWQVFKMEEELVIHQKIWV
FT                   SDFDNAQNHYRVNAPCNKGAEVFGILQIDLEPVKNEGLLELRSGPEGMFYEIHYELAME
FT                   VDGRNLAVKLFYPPGGMCRAQTQLCIAAAFIPGTE"
     atggctgacc tgcggcgcct tgcaacacgc aaacgacgcc gagcgtcgac aatagttgac        60
     caaaacgtct gcttcacggg cactgacaca gaagatgggg actcgatggt gccggagacc       120
     ccgcccagtc gcagctggag tcggagtcag agtcgcggga gcagccgaag cacgtggacc       180
     aatcaagcca caaccgagac gggaacggaa acatccgcga tcccgtcgac ggaaacttcc       240
     gtggaaccgt ccgtagaatt aactgaacca ttcacctcta ggtccacatc tgctcaatca       300
     gatacattgt caccgagaac caagttcatc attgggctcg attacggtac caccttctct       360
     tctgtctcct acatcaagtt cgattcggcc aggcctcctc cgactctctt tggagcgcaa       420
     atctgctcca ttaccgattg gcccggtgtc gacagccggg cacgcaacat tccagaagtc       480
     ccgagcgaga gttggtatct aggcgatcga ttctactggg gatatggcgc tcgccaaggc       540
     tatgcaaagc ttcttcttcc ggggaaccaa aaagaaactc gaggcccgcg tgaagaactc       600
     cggagaacct tggtaagggc tcgcaaggat gaaacagagg caatcaagga ctatctgcga       660
     cagatcttga agtatagcaa agaatttctc acagagagag aagaactcag tgaggagtgc       720
     gaggttgagc tcgtcttctg cgttccggct ggatggccgg caaaagcgat acgaacaatg       780
     caggaaatct tgcttgatat agcacatgaa ctcaatattg gtacccttgc aactccgttt       840
     gtcctcaatg agcccgaggc cgctgcggcg tatatacttg aagcgtgctc agggaggaaa       900
     aggctgtcaa caggagaagt gtttatggtt tgtgatgcag gtggtgggac cgtggatgct       960
     atcacttaca gagtctgcca acaacaccca tttcgagtgg aagaagttgt tcctcctact      1020
     ggaagcaact gcggatccag ctatgcaaac caaactctca agcaccaggc catagagaaa      1080
     atcaagagta cagcgtacga gtcactgaaa ggcccttctt ttgaatacat tattgagcac      1140
     gacatcatga ccgagtttga gtataaaatc aagagaggtt tcaatccggc agatgggctg      1200
     gacggggacg aagttatagt cgtgcacggg cttgagagga atgagcgttt gggatttgga      1260
     cacaacacca tgcgtattaa aagcttgaac ggtataagca aactcattcg ccagcaaatc      1320
     agtgcagcgg cagccaaggg cctcacggtc gagacaattc tgttggttgg aggtttctca      1380
     gctgccccca tcctccgctc tcatatagaa acagagttcg aagctttgaa gattatatat      1440
     ccgcccaagg ggcttgatag cgccgtgaca gtctcccacg gagctgtttt ccgtgcgttc      1500
     aacaaatctg acggccctaa gcgtattgtg cagtcaaatt ttggtttcct tcagttggaa      1560
     ctctacagca caagacaacc agctcatcga ggcgtttccc cgatttttaa cgccatagac      1620
     ggcaagaaat atggactagt tttgagcaag cagcaacagt ttcggactcg aaactggcag      1680
     gtcttcaaaa tggaggagga gctcgtgata catcagaaaa tctgggtgtc tgattttgac      1740
     aacgcccaaa accactaccg agtgaacgct ccttgcaata aaggcgcgga agtctttggt      1800
     atcctgcaga tagacctaga gccagtgaaa aacgagggcc tcctcgagct tagatcggga      1860
     ccagagggga tgttctacga gatccactac gaactggcaa tggaagttga cggaaggaac      1920
     ctggctgtaa agctcttcta tccaccaggg ggaatgtgtc gcgcgcagac gcagctttgt      1980
     atcgcggcgg ccttcattcc agggacagag tga                                   2013
//

If you have problems or comments...

PBIL Back to PBIL home page