(data stored in ACNUC16935 zone)

EMBL: BN001307.PE438

BN001307.PE438       Location/Qualifiers
FT   CDS_pept        complement(join(1217058..1217212,1217318..1218554,
FT                   1218610..1219108,1219167..1219642))
FT                   /locus_tag="ANIA_01589"
FT                   /old_locus_tag="AN1589.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008222"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008222"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008222"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ1"
FT                   /protein_id="CBF85171.1"
FT                   /translation="MPPMPSEEYRSRYRLTEDLKIKFLGPLEPEKWPTHWPEARRRLFH
FT                   DIVKLGDSKFGTFECTYSSEKPWRAQIKRRAAKLAYLASRCCDEGKNEPSWRASLEHEV
FT                   LYRFTVEVSCPTCRARLWRSEIEAAIESSDSQALSLDERRKHRMPCRCPEGFGTTDFHG
FT                   VNMIFSDRAETSIHYQPPLPIRSRSKGYKKYEQPDRVYGLIETQNIKTLLDSPYQRTTD
FT                   SQVKQLRDLLEVSPFKGDRKPLLFPFLLLEAKSATVGDSAGVEMQSAFTIHRLLKVQDE
FT                   LRAATRVDSMWATGPLVWFFGWHGQDWYVKGSFIDYTSGTPHRYCIVDLWQGNISQQSR
FT                   ALQLLLVVDYIFDWARDIYRPCIIRELSILAAREMQPCDPDIFSTVDRSQSQIASELPG
FT                   FSWSQESDSLYVSTTGLESGLGDTHPLSGVVRDASNIETRFLSLHITEANMDELWVSLP
FT                   AHLRESATTFVDTLRPSLDSSWRVTRKTLFSIQAAWTRNVNAPEFAGGSNTDIASDEIF
FT                   FTNIVILFHMTDDWTLVRQLTYLAISEGALQVLLLRHSLPGLLRDLEAQNPIIDDSSIE
FT                   PFIKSIRRQTIASSLTAAVSMLCISSSFTRGPGRIPGKWLLSKAKNIYAGFVFDNSPST
FT                   LEIVASFHETREKLIVNYFDDPYLVYSRTRTFLSADSPEQGLWPRLDSICQDKHGCALV
FT                   ESLNLPDNSTGAGARFCVFIISKYDFDRSDVDTATIVRGLAEGDSLGLLLEWLEDLGSQ
FT                   SGRAGWSGGGPGETPDSPIMISSSEESEGDPIEED"
     atgcctccaa tgccgtctga ggaataccgc agtcggtaca gacttactga ggatttgaaa        60
     atcaaatttc tgggtcctct cgagcccgaa aagtggccga ctcattggcc agaggcacgc       120
     cgacgcctct tccacgacat tgttaagctc ggcgactcga aatttggtac ctttgaatgc       180
     acttattcaa gtgaaaagcc atggcgagcc caaatcaaaa gaagggcagc gaaactggcg       240
     tacctcgcca gtcggtgctg tgacgagggc aagaacgagc cgagctggag ggcgtcgcta       300
     gaacatgaag tgctctaccg gttcacggtc gaggtatcgt gtccaacttg ccgagcaaga       360
     ctgtggcgct cagagattga ggctgccatt gagtctagtg attcccaggc gttatcgctg       420
     gacgagcgac ggaaacatcg tatgccctgc cgctgtcctg aaggctttgg caccacagat       480
     ttccacggcg tcaacatgat cttttccgat agagcagaga cctcaatcca ttaccaaccg       540
     ccgctcccca tcaggtctcg cagcaaaggc tacaagaaat acgagcagcc ggacagagta       600
     tacggattga ttgagacgca gaacatcaag acactattgg actcgccgta tcagagaacc       660
     actgacagcc aagtgaaaca gttgcgtgac ctcctggagg tgtcaccatt taaaggtgac       720
     cgcaaaccac ttctcttccc atttctgctc ctcgaagcca aatccgctac tgtgggtgac       780
     tcagcgggcg tggaaatgca gtcagctttt accattcata gactattaaa ggtgcaggat       840
     gaacttcgtg ctgcgacgcg agttgatagc atgtgggcga cggggccgtt ggtgtggttt       900
     ttcggatggc atgggcagga ttggtatgtt aagggtagtt tcatagacta taccagcggg       960
     accccccata gatactgcat cgttgacctc tggcaaggca acatctccca acaaagccgt      1020
     gcattgcaac ttctactcgt cgtggattac atatttgatt gggctcgaga tatctacaga      1080
     ccatgtatca tcagggaatt gtctatacta gcagccagag aaatgcagcc ttgcgatccg      1140
     gatatattct ccaccgttga ccggagtcag tcacagatcg catcggagtt gcctggcttc      1200
     tcctggtcac aggagtcgga ctctctgtat gtgagtacga cagggctcga gtctgggctc      1260
     ggggacactc atccgctttc tggagtggtg cgagatgctt ccaatattga aacaagattc      1320
     ctgagcctcc atatcactga agcaaatatg gacgagctgt gggtctccct gccagcacac      1380
     ctgcgggagt ctgcaaccac attcgtggac acattacgac cgtctctaga cagctcatgg      1440
     cgagttacta gaaagactct gttctccatc caagctgctt ggacaagaaa tgtgaatgct      1500
     ccagaatttg caggggggag caatacagat atcgcgtctg atgagatctt cttcactaac      1560
     atcgttattc ttttccacat gacagacgat tggactcttg tccggcaact tacatatctc      1620
     gccatctccg aaggcgctct gcaagtactg ctattacgac atagccttcc cgggctattg      1680
     cgggatctag aggcgcagaa ccccatcatt gacgactcca gcattgagcc cttcattaag      1740
     tccataagga gacagacaat cgcaagcagt ctaacggccg ctgtgagcat gctctgtatc      1800
     tccagctcct ttacccgagg ccctggccgg atcccaggaa agtggctcct tagcaaggcc      1860
     aagaacatct atgccgggtt tgtgttcgac aattcaccgt cgactctaga gattgtggcc      1920
     tctttccacg aaacacgtga gaaattgatc gtgaattatt ttgatgaccc ctatcttgtt      1980
     tattcgcgga cgcgaacctt cctctcagcc gatagccctg agcagggcct gtggccgcga      2040
     ctggactcta tatgtcagga caagcatgga tgcgcgttag ttgagagtct caacctgcct      2100
     gataactcta caggtgcagg tgcaagattc tgcgtcttca tcatatctaa gtatgatttc      2160
     gaccggtctg acgttgacac ggctaccatt gtcagaggct tggcggaggg ggatagtttg      2220
     ggtttgctgc tggagtggct agaagacctt ggttcccaat ctggaagggc aggatggtca      2280
     gggggaggcc caggggagac accagattcg cctattatga tatcatcaag cgaggagtcg      2340
     gagggagatc cgatagaaga ggactag                                          2367
//

If you have problems or comments...

PBIL Back to PBIL home page