(data stored in ACNUC16935 zone)

EMBL: BN001307.PE439

BN001307.PE439       Location/Qualifiers
FT   CDS_pept        complement(join(1221145..1221163,1221216..1222458,
FT                   1222513..1222711,1222781..1223021,1223089..1223267))
FT                   /locus_tag="ANIA_01590"
FT                   /old_locus_tag="AN1590.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008223"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008223"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008223"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ0"
FT                   /protein_id="CBF85173.1"
FT                   /translation="MGKEKHHFSRLPWRKSEPATDEDEAWIRKKAGAHHPAFRTPADYD
FT                   RSEKRYISDEEQAIEYLENLLRKHDDSQPGEPKFYQCSWEVVIQSLTQAQDAYAKNTGC
FT                   GQRTGMALDVTLSAFEALPAEFGLGTVKGILGLMFRVALQGIENRAKILDAFSSIPNTI
FT                   VTINVACTVLRPSQGDLDLREEFYRTLIKGMPLLVDVLLRAAPWYRKLKEILLFRIPET
FT                   VAVDEVLSEWKGIIDSFNQRMQRMRDRMLGTLHQQGVDLQNQADKHFSATENHFRGLRE
FT                   ENSTTHDMMRDLQLMMTVIMYNQKQLSKQKAQEASTWHHGLKSGADATTLLYQELQAIR
FT                   RQGEIQQEENSRLRRENVALREEAALRAETESSWKPTHPSMAALSELELLGVIGVPSNA
FT                   AWRDLDIVLSQSSSFGSQMLGKAQRLIRTRAFRDWFNQSESSILLVEGYLDISPAASIT
FT                   PISILDATLISSLLDSSNTLVLFAFAGLHREYEKPEVMNGPGGLLRSLIMQLLTSDKFP
FT                   LSNLEFLTPERIAACQKGDIVALCALFERLLLQVPPSLQVYCILDGLGWYERNPWGQDL
FT                   LYVISMFEELAQWDFPQTAVIKPMISFPHHSLLVADAVQIPVLWSRRYWD"
     atgggcaaag agaagcatca tttttctcgc cttccatgga gaaaatctga gccagcaacg        60
     gatgaggatg aggcatggat ccgaaagaaa gcaggggctc atcacccagc cttcaggacg       120
     ccggccgatt acgatcgaag cgaaaagcgg tacatctccg atgaggagca ggcgattgag       180
     tatctggaaa accttctccg caagcacgac gacagccaac ccggggagcc aaaattctac       240
     caatgctcct gggaggtggt catccaatcg cttactcaag cccaagacgc ttatgccaaa       300
     aatactggtt gcgggcaacg gaccgggatg gcgttggacg tgaccctatc agcattcgaa       360
     gccttgccag ctgagttcgg actgggtaca gtcaagggca tcctgggctt aatgtttcga       420
     gttgcactac aggggattga gaacagagct aaaatcttag acgcattctc ctcgataccc       480
     aatacgatcg tcaccattaa tgtcgcctgc actgttctac gaccgagcca gggagacctc       540
     gatctgagag aagagtttta caggacttta atcaagggaa tgccactgct ggtcgacgtg       600
     ctactgcgag cagcgccttg gtatcgcaaa ctgaaagaga ttctgctatt tcggattccc       660
     gaaaccgttg cggtggacga ggtcctgtca gaatggaagg gcataattga ctccttcaat       720
     cagcgcatgc agcgcatgag ggatagaatg ctcggcacgc tgcatcaaca gggggttgat       780
     ctccagaacc aggccgacaa acacttttcc gctacggaaa accatttcag aggactgcgc       840
     gaggagaatt ccacaactca tgacatgatg cgggatcttc agttaatgat gactgtcatc       900
     atgtacaatc agaagcagct ctcgaagcaa aaagcgcaag aggcaagcac atggcatcac       960
     gggctcaagt cgggagcaga tgccacgact ctcctctacc aagagttgca agccatcaga      1020
     cgccaaggag aaatccagca ggaggagaat tctcgtctca ggcgtgaaaa tgtggccctt      1080
     cgcgaggaag ctgcgctcag ggcagaaaca gagtcgtcgt ggaagccaac ccatccgtcg      1140
     atggcagcat taagtgagct ggagcttctg ggagtcatcg gcgtaccatc caatgccgct      1200
     tggagggatc tagacatcgt actgagccaa agttcatctt ttggctcgca aatgctcggc      1260
     aaggcccagc ggctgatcag gacaagggcg ttccgggact ggttcaatca gtcggagtcg      1320
     tcaatccttc tcgtcgaggg ctatctggac attagccccg cggcgagcat cacgcccata      1380
     tcaatcctcg acgccacctt gatctcgagt cttctcgaca gctcaaacac gctggtgctc      1440
     tttgcgtttg cgggtcttca ccgggaatat gagaagcccg aggtgatgaa tggaccgggt      1500
     gggctactcc gaagcctcat tatgcagctc ttaacgagtg acaagttccc tctgtccaac      1560
     cttgagtttc ttacacctga gcgaattgcc gcttgtcaga aaggggatat tgtagccctg      1620
     tgtgcactgt tcgagagact tctactgcag gtaccaccat ccttacaagt atactgtata      1680
     ctggatgggt tgggctggta tgaaagaaat ccctggggtc aggatctgct ttacgtgatc      1740
     agcatgtttg aggaactagc acaatgggac ttcccccaga cagccgtgat aaagcctatg      1800
     attagctttc ctcaccacag cctcctcgtc gccgacgcag ttcagatacc agtcctctgg      1860
     agtagaaggt actgggatta g                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page