(data stored in ACNUC16935 zone)

EMBL: BN001307.PE44

BN001307.PE44        Location/Qualifiers
FT   CDS_pept        join(119854..120392,120455..120491)
FT                   /locus_tag="ANIA_09018"
FT                   /old_locus_tag="AN9018.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007835"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007835"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007835"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR2"
FT                   /protein_id="CBF84450.1"
FT                   /translation="MTQSSHHVDDVSQFQEFEPWELNSQYAPTPGYIGSPYVSRSSYSP
FT                   SPSRELVNVPEAASQSRPDTLRLLQLSEWEEGRAYDENPPSCIHYLIEWRVTINNRVVA
FT                   KDTDEDLVLAPSAHWQLFLEDKLENVLRRKVSRNRRVRADDTEIVVSVNDRSHRDLTKR
FT                   FDNTDINWTAIEKQLVIGWTLSNRWTER"
     atgacccaaa gctcgcatca cgtcgacgat gtatctcagt tccaagagtt tgagccatgg        60
     gagctgaatt ctcagtatgc cccaaccccc ggatacatcg gcagccccta cgtctcgcga       120
     tccagctaca gcccttcccc atcccgtgag cttgtgaatg tacctgaggc ggcaagccaa       180
     tcacggccgg atactctcag actgctccag ctgtccgagt gggaggaggg aagagcgtac       240
     gatgagaacc caccgagctg tatacactac ttaatagagt ggcgtgtcac tatcaacaac       300
     cgggttgtgg ctaaggacac ggacgaggac ctcgtcttgg ctcctagtgc gcactggcag       360
     ctgttcttag aggataagtt agaaaacgtc cttcgacgaa aggtttcccg caaccgacgg       420
     gtgagggctg atgacaccga gattgtcgta tcagtgaatg atcgttccca tcgtgacttg       480
     accaagcgat tcgacaacac cgatataaac tggactgcca ttgagaaaca actcgtgata       540
     ggatggacgc tctccaaccg gtggacggag aggtga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page