(data stored in ACNUC16935 zone)

EMBL: BN001307.PE440

BN001307.PE440       Location/Qualifiers
FT   CDS_pept        join(1224169..1225990,1226088..1227040)
FT                   /locus_tag="ANIA_01591"
FT                   /old_locus_tag="AN1591.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008224"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008224"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008224"
FT                   /db_xref="GOA:Q5BCY9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY9"
FT                   /protein_id="CBF85175.1"
FT                   /translation="MNRTVGDDWDYTIEVCIGRPNLLEEIREELRRREAIEKKTYSGNH
FT                   RPLMAESPEKIGENRKLHRVRIRSPTVLSHLERLTRKLGNGSILNEEDNLVFMYPFYIL
FT                   GVYLDDMREILADMERGVLASGSIPPSEPEPKGLSPSVSPSPIDQMKCFVQFVESSILP
FT                   IHTALRQLDAQTSRRLSYAEISLLLEPGELIYVAPSLMTTKMLDRSAVQTVFRCLTRIP
FT                   ADHPISIDDSGWLSSDIGRLLADVYCLDHDGEEYTVCWRKLEMEYFDGEKDITALPFYP
FT                   LKFHPNYERFLSNRARQGTAFRALVEDENLHHYYAGWTLITGLFERTESDGKSTESKPE
FT                   DSEYVDSEVFLDTQEARRHMDDWSSLREPFTTKGSLAINDGAKFCLWHMTEKKTVAEKL
FT                   NRILTREDLVYWRARERYLLDNKWVIDDRVFIKEEWTDEDLALLPKRVYGYSLRDRKFL
FT                   RLDVDKFRPHTLKTKANLDKIEIKDSHRMIIRAAVKSHFDRAAQVLNRDEATHVPDIFE
FT                   GKGRGLVILLHGAPGVGKTATAEAVALEFDKPLFQITCGDLGTGPAEVETSLKAIFRYA
FT                   NMWSCILLLDEADVFLTQRNRTDVERNALVSVFLRVLEYYSGVLFLTTNRVGALDEAFR
FT                   SRVHLSLFYPHLNRTDMAKILESNLQRLPRDDKLSPGATAGPNHVTVMDSEIREFVLQQ
FT                   FDEHYKLHERGPWNGRQIRNAVHIAMCLAFFENGRKGRRAPAILTAEHFRKVHETIAEF
FT                   EDYLRAARTVDDETLAQMEGLRYDKEGQAYKRQLVGSTKFHRWSENERQVTHQRQSVRE
FT                   QGQSYRETTSYTPSRRSFLGGDIDSPPESRFSGSGAAARPTSQRYPPREIDDSHLAHER
FT                   YNMSDSGYGETGLRGTPRNYNLSPDRPRTPNRDYLVDGSPESVRSRSSVRGRD"
     atgaatcgaa ctgtggggga cgactgggat tatacgattg aagtctgcat cggccggccc        60
     aaccttctgg aagagattcg tgaagaactc aggaggagag aagcaatcga gaagaagaca       120
     tattccggca atcacaggcc tctgatggcc gaatctccgg aaaaaattgg tgaaaaccgc       180
     aagttgcacc gggtgcgcat aagatcgcca acagtgctca gtcatctcga acgtctaacc       240
     cgcaagctgg gtaacggttc tattttgaat gaggaggaca acttggtgtt tatgtacccc       300
     ttttacatct taggagtcta tcttgacgac atgcgtgaaa tcctagctga catggagaga       360
     ggagtgctgg cgtctggctc tatccccccc agcgagcctg agcccaaagg cctgtctcca       420
     tcagtgtcgc cgtcgcccat tgaccagatg aagtgcttcg ttcagttcgt ggaaagttcg       480
     atcctaccca tccataccgc tctccgacag ctggacgccc aaaccagtag aagattgtct       540
     tatgcggaaa tctcattgct gcttgagccg ggtgagctaa tctacgtcgc cccctcgctc       600
     atgacgacga agatgctgga tcgatcagca gtccagactg ttttccgatg tttgacccga       660
     atcccagccg atcatccgat cagcatcgac gacagcggct ggctgtcctc cgacatagga       720
     cgtcttctgg cggatgtata ctgcctggac catgatggtg aagaatacac cgtctgttgg       780
     cgcaaattgg agatggaata tttcgacggg gagaaagaca ttaccgcttt gcccttctat       840
     cccttgaaat ttcatccaaa ttacgagcga ttcctatcaa accgtgctcg gcagggaaca       900
     gcattccgag cgctcgtgga ggacgaaaac ttgcaccact actacgcagg ttggacgctc       960
     attactggtc tctttgaacg gaccgagtca gacggaaagt ccacggagtc caagccggag      1020
     gattcagagt atgtcgatag cgaggtcttt ctggacaccc aggaagcacg acgacatatg      1080
     gacgactggt cctctctccg tgagcctttc acaacgaagg gaagccttgc catcaacgac      1140
     ggcgcgaagt tctgtctatg gcatatgact gaaaagaaga ctgtggcaga gaagctgaac      1200
     aggatactca cgcgcgaaga ccttgtctac tggcgagcaa gggagcgata tctcctcgac      1260
     aacaaatggg tgatcgacga ccgggtcttt ataaaagagg aatggacgga cgaagatcta      1320
     gcgctgcttc ccaaaagagt ctacggatac tcgttacggg acaggaagtt cttgcggctg      1380
     gatgttgaca aattccgacc acacacgctc aagaccaaag ccaatctgga caagatcgag      1440
     atcaaagata gccaccgcat gataattaga gctgcggtca agtcccattt tgacagagcg      1500
     gcacaggtcc tgaaccgaga cgaggccact catgtccccg acatcttcga gggcaaaggc      1560
     cgcggtctcg tcatccttct tcatggcgcc cccggcgtcg gcaagactgc cacagcggaa      1620
     gcagtggcgc tagaattcga caaaccctta ttccagatta cttgcggcga tctgggcacg      1680
     gggcccgcgg aggtggaaac gtcactgaag gcgattttcc gctacgcgaa catgtggagc      1740
     tgcatcttgc tcctagatga agcagatgtt ttcctgactc agagaaaccg gacagatgta      1800
     gagcggaatg cgttggtctc agtgtttctc agggtcctag agtactacag cggggtcctc      1860
     ttcttgacca ccaaccgagt tggcgcacta gacgaagcct tccggtcgcg tgtgcacctc      1920
     agcctgttct atccgcatct gaaccgcact gatatggcga agatcctaga gagcaaccta      1980
     cagcgactac cgcgggacga caaattgagc cctggagcca ctgcaggccc aaaccatgtc      2040
     actgtgatgg acagtgagat ccgggagttt gtcctgcagc agttcgacga gcactataag      2100
     ttgcacgaga gaggaccctg gaatggacgg cagatccgca atgctgttca tattgccatg      2160
     tgcctggcct tctttgagaa cggcaggaag ggccgcaggg ctccggccat tctaaccgcg      2220
     gagcattttc gcaaagtcca cgaaactatt gccgaattcg aggactattt gagagccgct      2280
     cgaaccgtgg atgatgagac cctggctcag atggaaggat tgcgatatga taaagaaggg      2340
     caggcgtaca aaaggcaact tgtcggctct actaaatttc acagatggtc agaaaatgag      2400
     cgtcaagtga ctcatcaacg ccaatccgtc cgcgagcaag gacagtcata tcgggaaacg      2460
     acctcttata caccgtctag gcgctcattc ctgggtgggg atatcgactc tccaccagaa      2520
     tccaggttta gcggatcggg ggccgcagcg agaccaacca gccagcggta cccgccgcga      2580
     gaaatagacg actcccacct ggcgcacgag agatataaca tgtctgactc tggttacgga      2640
     gagacaggtc tgcgtgggac tccgaggaac tacaatttgt ctccagacag accacgaact      2700
     ccaaatcgtg actacttggt agacggctcg cctgaatcag ttcgctcaag gtcttcggtc      2760
     cgagggagag attga                                                       2775
//

If you have problems or comments...

PBIL Back to PBIL home page