(data stored in ACNUC16935 zone)

EMBL: BN001307.PE441

BN001307.PE441       Location/Qualifiers
FT   CDS_pept        join(1228831..1229145,1229204..1229358,1229419..1229827,
FT                   1229884..1230198)
FT                   /locus_tag="ANIA_01592"
FT                   /old_locus_tag="AN1592.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008225"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008225"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008225"
FT                   /db_xref="GOA:Q5BCY8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY8"
FT                   /protein_id="CBF85177.1"
FT                   /translation="MSPPLDSALEPLSEYKETAFPRTEKDPSQYKEHDLVTPEKEIQTG
FT                   YFSPRGSHSSHGSHDSSASSNISLDDARMSDVNNSPNVFHDDPDTIDEKLSMYWKAANE
FT                   TVIREPYDYIAGIPGKEIRRKLLEAFNHWYKVDEQSCQAIATTVGMAHNASLLIDDIQD
FT                   SSKLRRGVPCAHEVFGIAQTINSANYVYFLAQNQLFRLRSWPQAISVFNEEMVNLHRGQ
FT                   GMELFWRDNLLPPSMDDYLQMIANKTGGLFRMIVRLLQTSSRQVIDVEQLVDVLGLYFQ
FT                   ILDDYKNIREEKMAAQKGFFEDLTEGKFSFPICHAIGEGAKNRTALLHMLRLKTDDMKI
FT                   KQEAVCILDNAGSLDYTREVLYGLDRKARSLLREFKTPNPFMEALLDAMLSSLQACH"
     atgtcacccc cacttgactc tgccctggag ccactgtccg aatacaagga aacagccttt        60
     cccagaactg aaaaagaccc gtcgcagtac aaagagcacg accttgtaac gcctgaaaaa       120
     gaaatccaga ctgggtactt ttcgccgcgt ggaagccaca gcagccacgg ttctcacgac       180
     tccagcgcct cctccaatat cagcctcgac gacgcccgga tgtcagatgt gaacaattcg       240
     ccaaatgtat tccatgacga cccagatacg atcgacgaga agttgtcgat gtactggaag       300
     gcggcgaatg aaacggtgat tagagagccg tatgactaca tcgctgggat cccaggcaaa       360
     gagatccgcc gaaagctctt ggaggccttc aaccactggt acaaagttga cgaacagtcg       420
     tgccaggcta ttgcaaccac tgttggtatg gcacacaatg catccctgct catcgacgat       480
     attcaagaca gttccaagct ccgaagaggt gttccatgcg cacatgaagt gtttggcatc       540
     gcccagacca ttaactccgc caactatgtc tactttctgg cgcaaaacca gctgtttaga       600
     ctgcggagct ggccccaggc aatttcggta ttcaacgaag aaatggtcaa tttgcaccgc       660
     ggtcaaggca tggagctatt ctggcgggat aacctgctgc ctccgtccat ggatgactat       720
     ctgcagatga tcgctaacaa gacaggtgga ctgtttcgga tgatagtgcg gctgctccag       780
     acaagcagca gacaggtcat tgacgtcgag cagttggtgg atgttcttgg gctttacttt       840
     cagatcctcg acgactacaa gaatatcaga gaagagaaga tggccgccca gaaagggttc       900
     ttcgaagacc tgacggaggg caaattctcg ttccccattt gccatgcaat cggagaaggg       960
     gccaagaaca gaactgctct gctccatatg ttgaggctca aaacggatga catgaagatc      1020
     aagcaagaag cagtctgcat actggacaat gctggcagtt tagattacac gcgagaggtg      1080
     ctttacgggc tggacaggaa ggctcgcagt ctgcttcggg agttcaagac tccgaaccct      1140
     ttcatggagg ctcttttgga tgcaatgttg agcagccttc aggcatgcca ttga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page