(data stored in ACNUC16935 zone)

EMBL: BN001307.PE442

BN001307.PE442       Location/Qualifiers
FT   CDS_pept        join(1231956..1232938,1232998..1233265)
FT                   /locus_tag="ANIA_01593"
FT                   /old_locus_tag="AN1593.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008226"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008226"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008226"
FT                   /db_xref="GOA:C8VN86"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN86"
FT                   /protein_id="CBF85179.1"
FT                   /translation="MPESQIIELGTLGQIPLYSLERALQDPLRAVKLRRQIVSQHQATG
FT                   NIDFTTDGSALPYEGYDYKAVLGACCENVIGYMPIPVGVAGPIKINGKMVFLPMSTTEG
FT                   ALVASTNRGCMAINAGGGVTALVLGDGMTRAPIVRFPSLEEAGAAKQWLGSDAGFLIIE
FT                   DAFNASSRFARLQNIKATAVGSDLYIRFTASTGDAMGMNMISKGVEQALEAMQKHGFES
FT                   MDVVSLSGNFCADKKPAAVNWIEGRGKTVTAQATIPEHAVRETLKTSVEALVELNVSKN
FT                   LVGSAVAGALGGFNAHAANVVTAIYLATGQDPAQNVQSSNTLTVMKNVNGDLQISVFMP
FT                   SIEVGTVGGGTVLGPQKAMLHMMGVQGADPEQPGRNAQELALLVAAGVLAGELSLCSAL
FT                   SAGSLVKSHLTHNRKKG"
     atgcctgaga gtcagatcat cgaactgggc acgctgggcc agatccccct ttacagcctt        60
     gaacgcgcgc tccaggaccc tcttcgggct gtcaaactgc gacggcaaat cgtctcccag       120
     catcaagcca ctggcaacat cgacttcaca acggacggct ccgcgctccc gtacgaagga       180
     tacgactaca aagcagtcct cggagcctgc tgcgagaacg tgatcgggta tatgcccatc       240
     cctgtgggcg tcgccggtcc gatcaaaatc aacggaaaga tggtgtttct ccccatgtcc       300
     acgacagagg gcgcgctggt tgcgagcacg aatcgtggct gcatggcgat caacgccggt       360
     ggaggcgtga ctgctctggt gctgggcgat ggcatgaccc gagcgcctat cgttcgattt       420
     cccagtctcg aagaagccgg cgccgcaaaa caatggctgg gctctgatgc aggatttctc       480
     atcattgagg acgcgttcaa tgcatccagc cgcttcgctc ggcttcaaaa cattaaggcc       540
     acggccgttg gctcggacct ctatatccgg ttcacggcca gcacgggcga cgcaatgggc       600
     atgaacatga tctccaaagg ggttgagcaa gcgctggagg cgatgcaaaa gcacgggttc       660
     gagtctatgg atgtcgtctc gctgtcgggg aacttctgtg cggataaaaa acctgcggct       720
     gtgaactgga ttgaggggcg aggcaagacc gtgaccgcgc aggcgacaat acctgaacat       780
     gcggttcgag aaacactcaa gaccagtgtc gaggccctcg tggagctcaa cgtctccaag       840
     aacctggtgg gcagtgctgt tgcaggggct ctgggagggt tcaacgccca tgccgccaat       900
     gttgtcacgg cgatttatct tgccactggt caggatcccg cacagaatgt gcaaagcagc       960
     aacactctga ccgtgatgaa aaatgtgaat ggtgatttgc aaatctctgt tttcatgcct      1020
     tccattgaag tcggcaccgt tgggggaggg acagtcctgg gccctcaaaa ggcaatgctg      1080
     cacatgatgg gcgtccaagg ggccgacccc gaacagccag gtagaaacgc acaggagctg      1140
     gccctgctgg tggcggctgg cgtgctggct ggagagctca gtctttgctc tgctctgtca      1200
     gcgggctcgt tggtgaaaag ccacttgacc cataatcgga agaaaggatg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page