(data stored in ACNUC16935 zone)

EMBL: BN001307.PE443

BN001307.PE443       Location/Qualifiers
FT   CDS_pept        complement(join(1233605..1235293,1235348..1235634,
FT                   1235697..1236660))
FT                   /locus_tag="ANIA_01594"
FT                   /old_locus_tag="AN1594.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008227"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008227"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008227"
FT                   /db_xref="GOA:Q5BCY6"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR017057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY6"
FT                   /protein_id="CBF85181.1"
FT                   /translation="MTCADVTDLCTQASQLVQQLRTKDGELGFMSAAVYDTAWVSMVQK
FT                   TTPEGRQWLLPKCFEYILRTQLEDGSWETYASDVDGILNTAASLLALETHAESRIASTD
FT                   PPVEEMKERIGRARAALSRQLQAWSVKDTVHVGFEIILPALLRLLREKGHEFEFDGRAE
FT                   LDRLNRIKLSKFRPEYLYSARTTALHSLEAFVGMIDFDKVAHQKVNGSFMFSPSSTAAF
FT                   LMFSSSWDDECEQYLRLVLQNGAGGGTGGMPSAYPSKYFEVSWVRGQLARLESKLTELQ
FT                   ALTTLLDNGYSTGDLGIEDTDSLGEMLRDALVKGGGIVGFAPSIQADADDTAKSLIAVS
FT                   LLDKPVSAQGLIDAFEGPMHFRTYHGERDPSFTANSNVLLALLNTPDAATVSPQIEKAA
FT                   AFLCDVWWTADSEIGDKWNLSPYYPSMLMAEAFGKLLQVWSDGGLKSISSQFIRDRVSV
FT                   CLYQALVRTLQTQNENGSWGSHSHEETAYAILTIAHACQLPVVNQLWTNVQLAVSRGRK
FT                   FLQNSAGDKAEYLWVEKVTYSSILLSKSYVLAALKVSFERSYPACLANLFIVSKKRVIE
FT                   FARFHSMLPLFSSMELWKVRAAIVEGYLLLPQLRDRRLAVFSRTGMEEDKYFEYIPFTW
FT                   TLCNNRRNTFLSTKTLVEMMVISFLNYQADEFMEAVVGRLNSSQRSMTRSCIDEIFRDL
FT                   KDKPELNDAIQAQSGPRNADANGHRILPQAKRIKMGSQLPSDVSRVLSAFVHHVMDHPS
FT                   VKAAAPLEYERVKNELQVFLLSHIEQADDNGRFAAQLESTRDDFETARSSFYRWVSSTS
FT                   SDHTSCPYSFAFYQCLLGFEQASHNAACFQTCEEKYVAEAMCRHLAVMCRMYNDYGSLA
FT                   RDRDEKNLNCVNFPEFAQAGPKSDAVRQKQLFSLAEFERSNMKRGLEVLTEMAAQDRAK
FT                   MRMLEKVQMFCDVTDVYGQIYALEILRVGCDLAHDCFMLELPAQWSNST"
     atgacttgcg cagacgtgac agatctatgc acgcaagcct cccagctggt ccaacagctc        60
     cggacaaaag atggagagct gggctttatg tccgcggcag tctacgacac ggcctgggtg       120
     tccatggtcc agaagacgac accagaaggg cgtcaatggc tcctgccaaa atgcttcgaa       180
     tacatcctgc ggacccagct agaggatggc agttgggaga cctacgcctc cgacgtcgac       240
     ggtatcctca acaccgcagc ctccttactg gccctcgaga cccatgcaga aagccggatt       300
     gccagcaccg accctcccgt ggaagaaatg aaggagcgaa tcggacgggc acgcgcggcc       360
     ctctcacgac aactgcaagc gtggagtgta aaagacactg ttcacgttgg ctttgaaatc       420
     attttgcccg cgcttctgcg gctcctgcgc gagaaagggc acgagtttga atttgacggg       480
     cgcgccgagc tcgaccggct gaatcgcatc aagctctcca agttcaggcc ggagtacctg       540
     tactccgcca gaaccaccgc gctgcactcg cttgaggcgt ttgtgggcat gatcgacttt       600
     gataaagtgg cgcaccagaa ggtcaatggc tctttcatgt tctcgccatc gtccacggcc       660
     gcctttctca tgttttcctc ctcctgggac gacgagtgcg aacagtactt gcggttggtg       720
     ctacagaatg gcgccggagg gggcactgga ggaatgccga gcgcgtatcc ttcaaagtat       780
     ttcgaggtct cgtgggtaag gggacagctt gctcgactag aatcaaagct gactgaactt       840
     caggccctta ccacgctctt ggacaatgga tattctacag gcgatctcgg tatcgaagac       900
     accgacagcc tcggcgagat gcttcgcgat gcgttggtca aaggaggagg tattgtagga       960
     tttgctccgt cgatccaggc agacgccgac gataccgcca aatcgcttat tgcggtctcc      1020
     ttgttggaca aaccagtctc ggcccaggga ctaatagatg cattcgaggg cccgatgcac      1080
     ttccgcacct atcacggcga gagagatccc agcttcactg caaacagcaa tgtattgctt      1140
     gcgctgttga atacgcccga tgcggccact gtgtcgcccc agatcgaaaa agcagcggcc      1200
     tttctgtgtg atgtctggtg gacggccgac agtgagattg gggataaatg gaacctctcc      1260
     ccgtactatc catccatgct catggctgag gcgtttggga agctgctgca ggtatggtca      1320
     gatggcggac tcaagtcgat ttccagtcag tttatcagag atcgagtatc ggtctgcctg      1380
     tatcaggcat tggttcgcac actacagact cagaacgaga acggatcctg gggatcgcac      1440
     tcccacgaag agacggcata tgctattctg accatcgctc acgcatgcca gttgcccgtg      1500
     gtgaatcagc tgtggacgaa tgtgcagctg gctgtgtctc gaggccgcaa gttcctgcaa      1560
     aacagcgcag gcgacaaagc ggagtatctg tgggtagaga aggtgacata cagctcaatt      1620
     ctcctcagta agagctatgt cctcgccgcg ctgaaggtgt ccttcgaacg ttcttatcca      1680
     gcctgtctgg cgaatctgtt catcgtcagc aagaagcgtg tcatcgagtt cgcacgcttc      1740
     cactccatgc ttcccctgtt ttcgagcatg gaactctgga aggtccgcgc tgccatcgtc      1800
     gaaggatacc tgctcctgcc acagctgcgc gaccgacgtc ttgccgtctt ctctcgcacg      1860
     ggcatggaag aagacaagta ttttgagtac attccgttca cctggaccct gtgcaataac      1920
     cgcaggaaca ccttcctctc cacgaaaacc cttgtcgaga tgatggtgat ttcgttcctc      1980
     aactaccaag ccgatgaatt tatggaagcg gtagtcggca gactgaacag cagccagaga      2040
     tccatgaccc ggtcctgcat cgacgagatc ttccgcgacc tcaaggacaa accggagctg      2100
     aatgacgcaa tccaggccca gtctggtcca agaaacgcag acgcaaacgg tcacaggatc      2160
     ctaccgcaag ccaaacgcat caagatgggg tcacaactcc caagcgacgt gagccgcgtc      2220
     cttagcgcct tcgtccacca cgtcatggac catcccagcg tgaaggccgc cgcgcccctc      2280
     gagtacgagc gcgtcaagaa cgagcttcag gtcttcctgc tgtcgcacat agagcaggcc      2340
     gacgacaacg gccgcttcgc cgcccaactg gagtccaccc gcgacgactt cgagaccgcc      2400
     cgctccagct tctaccgctg ggtgtcttcc acctcgtccg accacacctc ctgcccctac      2460
     tcgtttgcct tctaccagtg cctgctgggg ttcgagcagg cgtcccacaa cgccgcgtgc      2520
     tttcagacct gcgaagagaa gtatgtggct gaagcaatgt gccgccatct cgccgtgatg      2580
     tgccgcatgt acaacgatta cggatcgctt gcccgtgacc gcgacgagaa gaatctcaac      2640
     tgcgtcaact ttcccgagtt tgcccaggcc gggccaaaat cagatgcggt tcggcagaag      2700
     cagctgttct ctctcgctga gtttgagcgg tccaacatga agcggggctt ggaggtcttg      2760
     acagagatgg cggcgcagga tagggccaag atgaggatgc tggagaaggt gcagatgttt      2820
     tgcgacgtga ctgatgtgta cgggcagatt tacgctttag agatattgcg agtcggatgt      2880
     gatctcgcac atgattgttt tatgcttgaa ttacctgcac aatggagtaa ctctacatga      2940
//

If you have problems or comments...

PBIL Back to PBIL home page