(data stored in ACNUC16935 zone)

EMBL: BN001307.PE444

BN001307.PE444       Location/Qualifiers
FT   CDS_pept        join(1237447..1237451,1237508..1237655,1237729..1237918,
FT                   1237985..1238442)
FT                   /locus_tag="ANIA_01595"
FT                   /old_locus_tag="AN1595.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008228"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008228"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008228"
FT                   /db_xref="GOA:Q5BCY5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY5"
FT                   /protein_id="CBF85182.1"
FT                   /translation="MNTLNAPRNPTRHPAMTADTLVDAPALPHQNGSTEEKLKERGSFG
FT                   KLYTYKRSPRALGIQAVAKSIGLELEQVELQPANGVPDFYWNLNPLGKTPTFVGADGLV
FT                   LTECMAIALHVTNEDSTTTLLGSSSLDFVQIIRWISFTNTDVVTRMASWVRPLIGYTPY
FT                   SKEEVLKAQQQTTQAIGVFEDSLRDRKYLVGDRLTLADIMCVSLVSFGFAQIFDKEWRE
FT                   AFPYFSGWYMMVMHLPIMKAVVEEVPFVEEGLPNAPPTEPFRAP"
     atgaatactc tcaatgcacc ccggaatccc acgcgtcacc cagctatgac cgcggatacg        60
     cttgtcgacg caccggctct gccgcatcag aatggcagta cagaagagaa actgaaggag       120
     cgcggaagct ttggaaagct ctacacgtac aagcggagcc cccgagccct aggcatccaa       180
     gctgtcgcaa aatccatcgg cttggagctg gagcaagtcg agctgcagcc ggccaacggc       240
     gtcccagact tctactggaa cctgaacccg ctgggcaaga ccccgacgtt tgtcggcgca       300
     gacggcctgg tgctgacgga gtgtatggcg attgccctgc acgtgaccaa cgaagactcg       360
     acgaccacgc tcctgggcag cagctcgctc gacttcgtcc agatcatccg ctggatctcg       420
     ttcaccaaca cggatgtcgt cacccgcatg gcgtcctggg tccggccgtt gatcggctac       480
     acgccgtaca gcaaggagga ggtgctcaag gcgcagcagc agacgacgca ggccatcggc       540
     gtcttcgagg acagcttgcg cgaccgcaag tatctcgtgg gcgaccgcct gacgctggct       600
     gatatcatgt gtgtcagctt ggtgtcgttt gggttcgcgc agatcttcga taaggagtgg       660
     agggaggcct ttccatactt ttcgggctgg tacatgatgg ttatgcattt acccatcatg       720
     aaggcagtgg tggaggaggt gccgtttgtc gaggagggct tgccgaatgc accgcccacg       780
     gagccgttca gggcgcctta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page