(data stored in ACNUC16935 zone)

EMBL: BN001307.PE445

BN001307.PE445       Location/Qualifiers
FT   CDS_pept        complement(join(1238668..1239317,1239372..1239723))
FT                   /locus_tag="ANIA_01596"
FT                   /old_locus_tag="AN1596.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008229"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008229"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008229"
FT                   /db_xref="GOA:Q5BCY4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY4"
FT                   /protein_id="CBF85184.1"
FT                   /translation="MVSLKTVQASNAGLRALPNITALFVGGTSGIGQSTLRQLARYADS
FT                   PTAYIIGRNEARTRPFLSELQQLNPKGRFHFIEADVSLVRNVDAACQQILQQQKKLNFL
FT                   FMTPGGISLGGRNETVEGIDYLFALRYYSRMRFIQNLLPLLEASSPSRVISVYGGGFEY
FT                   SINTADLDLKHNFSLLNAYKHSITMTSLSMEHLARTHPAVSFIHVYPGLVGTNIYTNSF
FT                   PAPVSTFYNYLVWPFMKPFSVDLGESGERHLFHLSSAHYPAKQGIVPQGVPLEAGEVAK
FT                   GITGEPGSGAYLLNWKGDVRPSTKILAQYREQKIPQLVWDHTESLMDQAVHR"
     atggtctctc tgaagacggt gcaagcatct aacgccggcc ttcgggcgct ccccaacatt        60
     acggccttgt ttgttggcgg caccagtggc atcggccaga gcaccctgcg ccagctggcc       120
     cgttacgccg acagcccgac ggcctatatc atcggtcgca acgaggctcg cacccggccg       180
     ttcttgtcgg aactgcagca attgaacccc aagggccgct tccacttcat cgaggcggat       240
     gtgtcgctcg tacggaatgt ggacgccgcg tgccagcaga ttctccagca gcagaagaag       300
     ctgaactttc tcttcatgac cccgggcggg atttctctag ggggccgaaa cgaaaccgtc       360
     gaaggcatcg actacctctt cgctctccgc tactactccc ggatgcgctt tattcagaac       420
     ctcctcccgc tgctggaggc gtcgagccca agccgcgtga ttagcgtcta cggcggcggc       480
     ttcgagtact ccataaacac ggccgacctc gacctcaagc acaacttctc cctgctcaac       540
     gcctacaagc actccatcac catgacctcc ctgagcatgg agcacctcgc ccgcacccac       600
     ccggccgtca gtttcattca cgtctacccg ggtctcgttg gcaccaacat ctacaccaac       660
     agcttcccag ctccggtttc gaccttctac aattacctcg tgtggccgtt catgaagccg       720
     ttttccgtgg atctcggcga gagtggcgag cgacatcttt tccatctgag ctcggcacac       780
     tacccagcaa agcagggcat tgtgccccag ggtgttccgc tggaggctgg cgaggtcgct       840
     aaaggcatta ctggggaacc ggggagtggc gcctacctgt tgaattggaa gggggatgtt       900
     aggccgagca ccaagattct ggcgcagtat cgggagcaga agatacctca gttggtttgg       960
     gatcatactg agagccttat ggaccaggca gttcatcgat ag                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page