(data stored in ACNUC16935 zone)

EMBL: BN001307.PE446

BN001307.PE446       Location/Qualifiers
FT   CDS_pept        join(1239993..1240282,1240340..1240851,1240943..1241028)
FT                   /locus_tag="ANIA_01597"
FT                   /old_locus_tag="AN1597.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008230"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008230"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008230"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY3"
FT                   /protein_id="CBF85186.1"
FT                   /translation="MVDATSPPGVNAVVNYYVPNSDGSPPATNDMAVMLGQKDMISHKM
FT                   RIRDLRPYKEEYSLDRNGFQYATIHSTLTDATDETQIKEVYYREIEKLVQDITGAKRVL
FT                   AFHHAVRTRTGNEFGEQIKDRYQGVEGPAYRVHIDQTPQGALSIVQFMFPDLADDVRNG
FT                   SFQVINVWRPLTRVQRDPLMVADAAEMPPEDLLLISRKYYNGLHSSNFVIKYDGRMAAG
FT                   EGPTDGLSGDGKHSWWYIGDQEPTEALVFSSSGFRNGKAIIGTAHDLYSAEPMINAYER
FT                   KNASSLYGHDESQI"
     atggttgatg caacgtctcc ccccggcgtc aacgcagtgg tgaattacta cgtgcccaac        60
     agcgatgggt ctccgcctgc caccaacgac atggccgtca tgctgggcca aaaggacatg       120
     atttcccaca aaatgcgaat ccgcgatctg cgcccttaca aggaggagta ttcgctggat       180
     cgcaacggct tccagtacgc gacgatccac tccacgctta cggatgccac cgacgagacc       240
     cagatcaaag aggtctacta ccgagagatt gagaaactgg tccaagatat caccggggcc       300
     aagcgggtgc ttgccttcca ccatgcagtg cgcacccgca ccggcaacga gttcggcgag       360
     cagatcaaag accgctacca gggcgtcgag gggcccgcgt atcgcgtaca cattgaccag       420
     accccccagg gcgcgctcag catcgtgcag tttatgtttc ccgatctcgc ggacgatgtc       480
     cgcaacggca gtttccaggt gatcaacgtt tggcgcccgt tgacgcgggt gcagcgtgac       540
     cccctgatgg tggctgatgc ggccgagatg ccgcccgagg acctgcttct aatcagccgg       600
     aagtattaca acgggctgca ttcgtccaac tttgtcatta agtatgatgg tcgaatggcg       660
     gctggggagg gcccgacgga tgggctgagc ggtgatggaa agcatagctg gtggtatatc       720
     ggggaccagg agcccaccga agcgttggtt ttctcctcat ctggcttccg caatggaaag       780
     gcgatcatcg gcacggcaca tgacctttac tcggcagaac caatgataaa tgcatatgaa       840
     cgcaagaatg ctagctcatt atatggccat gatgagtccc agatatag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page