(data stored in ACNUC16935 zone)

EMBL: BN001307.PE449

BN001307.PE449       Location/Qualifiers
FT   CDS_pept        complement(1249097..1250053)
FT                   /locus_tag="ANIA_01600"
FT                   /old_locus_tag="AN1600.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008233"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008233"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008233"
FT                   /db_xref="GOA:C8VN93"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN93"
FT                   /protein_id="CBF85192.1"
FT                   /translation="MPSGRSNSNITMAQLLVVLGATGQQGISVINHVLSDPILSSKYSI
FT                   RGVTRDASKPAAQDLMMKSLDIVSADFDDPASIYAALRGAHTVFAMTCTIYDEHAKTRE
FT                   EDQGKTIADAAVAVGARYLIWSTATHAGNTSGGKYSVPAFDVRWDVEQYIRGLPIQSAF
FT                   VAPATFMQNLRDMMAPQPCEDGTYAIANIHSPQTRFPWLDVVADLGKFVGAILEQPEKY
FT                   DGKVLGASSCIHSLVEVAQILSKVSGRTVKYVVMPESKFRSFCPPDGADSIVNMFLFIQ
FT                   DYGYYGVETEKVVEWSIQQVTGRLITIEEFAKTLHFA"
     atgccctctg gccgatctaa cagtaatatc accatggcgc aacttctcgt tgtcttgggc        60
     gcgacgggcc agcaaggcat ctccgtcatc aaccacgtct tgtctgaccc cattctctcc       120
     agtaaatatt cgatccgtgg cgtcacacga gatgcctcga aaccggctgc acaagatctc       180
     atgatgaagt cactcgatat tgtctcggcg gacttcgacg acccggcatc gatctatgct       240
     gccttacgag gcgcacacac cgtcttcgcc atgacatgca caatctatga cgagcatgcc       300
     aaaacacgtg aagaagacca gggtaagact atcgccgatg cggccgttgc cgttggagcg       360
     cggtacctga tctggagtac tgcgacgcac gccgggaaca cgtccggcgg gaaatattca       420
     gtccctgcat tcgatgtccg ctgggacgtc gagcagtaca tacgcggcct ccccatccag       480
     agcgcgtttg tggcgccggc taccttcatg cagaatctgc gcgacatgat ggcacctcag       540
     ccgtgtgagg atggcacgta cgccatcgcc aacatccact ctccgcagac gcggtttccc       600
     tggctggatg tcgtggcgga cctggggaag tttgttggtg ccattctcga gcagccagag       660
     aagtacgacg gtaaggtgct tggggcctcg tcttgcattc attcgcttgt agaggtggcg       720
     cagattctca gcaaggtgtc tggcaggaca gttaagtatg tggtgatgcc ggagtccaag       780
     ttccgatcct tctgtcctcc tgatggtgcg gacagcattg tgaatatgtt tctgtttatt       840
     caggactatg ggtactatgg tgtggaaaca gaaaaggtgg ttgagtggtc gatccagcag       900
     gtcacaggac gccttattac catcgaggag tttgccaaaa ctcttcactt tgcgtaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page