(data stored in ACNUC16935 zone)

EMBL: BN001307.PE45

BN001307.PE45        Location/Qualifiers
FT   CDS_pept        complement(join(120620..120834,121121..121301,
FT                   121545..121875,121929..122309,122363..122820))
FT                   /locus_tag="ANIA_09017"
FT                   /old_locus_tag="AN9017.4"
FT                   /product="Putative C2H2 finger domain transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007836"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007836"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007836"
FT                   /db_xref="GOA:Q5ARR3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR031348"
FT                   /db_xref="InterPro:IPR039327"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR3"
FT                   /protein_id="CBF84452.1"
FT                   /translation="MSGLEALGIAASIIQVADLGTKLSVKLFSFYKQFKDANESMHFLS
FT                   SEIAFVSAILRELGDTLKDEESSKLCSEEAFRSLKHTLDQCRDVLEQIQRVTSHTDRSG
FT                   KTRFQQVAGKFRMVLLEPSLDPLKNRLERLKSTMLLLLNVIMYAGQIRSSHGFPPLLQD
FT                   QRVLMDSLLKDKIKNGQEPRQFAVAEQCPKAPSVSTSSNGAHADIDGTIDTDEPAEFKE
FT                   YNLLIQKMLQEIGRCKYKLEESRHSRIKTGVLNIHSGEIMRFQLEYGHHVRTDHSLFTE
FT                   EKASRQMANVRKDENRPQRPIASTEATGANMPDNRTDGPPEVTVSSLTRESRRPSPRLA
FT                   KGKEPRESIFDLPLSPVPLAPVKEEEPVQSSNLTKETTALPTPYMFPATTVKSSAPIPG
FT                   AQQHNRPRRRYEEIERMYKCGWNGCEKTYGTLNQLNSHVTMQSHGAKRTAGEFKEIRKE
FT                   WKARKKEENAQRKAAEEYERAATQAALTSQVEPPGLFPDNLEDLLLRWTTLDRREICVE
FT                   VPAC"
     atgtctgggc ttgaggcttt aggtatcgct gccagcatca ttcaagtggc agacctgggc        60
     accaaattat cagtcaaact attttccttt tacaaacaat tcaaggatgc caatgagtct       120
     atgcacttcc tttccagcga aattgctttt gtgagcgcga tcttgcggga gttgggtgac       180
     actttgaaag atgaggagtc atctaagctt tgttccgagg aggcatttcg aagtctaaaa       240
     cataccctgg accagtgtcg agacgtcctc gagcaaattc aaagagtgac cagccatacc       300
     gaccgatctg ggaagacgcg ctttcaacaa gttgctggga agtttcgaat ggtattactt       360
     gagccaagct tggatccatt gaagaatcgc ttggaaagac tgaagtcgac aatgcttctc       420
     ttgctcaacg ttattatgta tgcgggtcag attcgaagca gccacgggtt tccaccctta       480
     ctccaagacc aacgtgtctt aatggacagc cttctgaagg ataaaataaa gaacggtcaa       540
     gagccacgcc aattcgccgt tgctgaacaa tgtccaaaag ccccatcagt atctacaagc       600
     agcaatggag cccacgctga cattgatggg accattgata ccgatgaacc cgccgagttc       660
     aaagagtaca acctccttat ccaaaagatg cttcaagaaa ttggcaggtg caagtacaag       720
     cttgaagaaa gccgtcactc acgaatcaaa actggcgtct tgaatataca ctcaggtgaa       780
     atcatgcgct ttcaactaga atatggacat catgttcgca ctgaccattc actctttacc       840
     gaggaaaaag ccagcaggca aatggccaac gtgcgaaagg atgagaatag gccccaacga       900
     ccaattgcca gtactgaagc caccggggct aatatgccag acaatcgcac tgatgggccg       960
     cccgaggtca ctgtcagctc cctaacccgg gaaagccgca gaccgagccc tcgattagcc      1020
     aagggcaagg agccccgaga gtcgatcttt gatctgccac tatcaccggt tcctctggcc      1080
     ccggtcaaag aagaggaacc agtacaatcg tcgaacttaa cgaaggaaac gacagctctc      1140
     cccactccat atatgtttcc ggctacaacg gtgaaatcct ctgccccaat ccctggcgct      1200
     cagcagcaca atcgcccccg tcgccggtac gaggaaattg agcgcatgta caaatgtgga      1260
     tggaatggtt gcgagaagac gtacggaact ctgaaccaac tgaatagtca cgtgacgatg      1320
     cagtcgcacg gtgcgaagcg cactgctgga gaattcaagg agatccgcaa ggaatggaaa      1380
     gctcggaaga aggaggaaaa cgcccaacgc aaggctgccg aggagtatga gcgtgccgcc      1440
     acccaggctg cgctgaccag ccaggttgaa ccccccggcc tgtttccaga caaccttgaa      1500
     gacttgctgt tacgatggac gaccctggat agacgtgaaa tttgcgttga agtaccagca      1560
     tgttaa                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page