(data stored in ACNUC16935 zone)

EMBL: BN001307.PE452

BN001307.PE452       Location/Qualifiers
FT   CDS_pept        complement(join(1259861..1259929,1260008..1260347,
FT                   1260417..1260585,1260675..1260816,1260880..1260945,
FT                   1261010..1261056,1261171..1261249))
FT                   /locus_tag="ANIA_09443"
FT                   /old_locus_tag="AN9443.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008236"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008236"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008236"
FT                   /db_xref="GOA:Q5AQI7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQI7"
FT                   /protein_id="CBF85197.1"
FT                   /translation="MEETRVNLLEYLRSKTQVDLDTFDITGISFPRLLEHTLNLETVAA
FT                   GLHDQFPEVTFDELGVEVGAVLLAGEMVPAFTGNLHLMVNPSYAYSREKVIEAAKSTPS
FT                   PISLYPVLPATWEGLQACRDLQAFKIKTLGTTLFSMEQAILAGEAGCVSISPFVHSLRI
FT                   LVDPEYKDPHPVYNLSAQAQRWYRRQSLPTKVKSCSTVGVDELLELAGIDALTIIPDDL
FT                   RALQSTYRDANQVFKLSIVENGTQNDDKIEHISYINDEEKYRADFQKADEGRAKAKTAE
FT                   AIDIFCGFQAKAEDVIRKAKGQ"
     atggaagaga cccgcgtcaa tctgcttgag tatctccggt caaagactca ggtcgacctc        60
     gacaccttcg atataacagg tatttcgttc ccccgactac tagagcatac cttaaacctt       120
     gaaacagttg ccgcgggcct ccatgatcag ttcccggagg ttacctttga tgaactaggc       180
     gtggaagtcg gggcggtcct tcttgcagga gaaatggtcc cagctttcac cggtaatctc       240
     catctcatgg tcaatccaag ctacgcttac tccagggaga aggttatcga ggccgcaaag       300
     agcacgccct cccccatctc gctataccca gttctccctg cgacgtggga aggactccag       360
     gcatgccgtg acctgcaagc tttcaagatc aaaacgctgg gaactacgct cttctccatg       420
     gagcaggcca tactagctgg agaggcaggc tgcgtatcta tttcaccatt tgtgcacagt       480
     ctcaggatac tggttgatcc cgaatacaaa gaccctcatc ctgtgtacaa cctgagcgcc       540
     caagcgcagc gctggtatag gcggcagtcg ctgccgacaa aggtcaaatc atgctccaca       600
     gtgggtgtgg atgaacttct ggaacttgcg gggatcgatg cgctcaccat catccctgac       660
     gatcttagag cactacagtc gacctatcgg gatgcgaacc aggtttttaa actgtcaata       720
     gttgagaatg gaactcagaa tgacgacaag atcgaacata tttcgtatat caatgacgaa       780
     gaaaagtatc gggctgactt tcagaaggca gatgagggga gagcaaaggc gaaaacggcc       840
     gaggcaattg acatcttctg cggctttcag gccaaggctg aagatgtcat ccggaaagcg       900
     aagggtcagt ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page