(data stored in ACNUC16935 zone)

EMBL: BN001307.PE453

BN001307.PE453       Location/Qualifiers
FT   CDS_pept        complement(join(1263264..1263505,1263560..1263645,
FT                   1263728..1264113,1264165..1264245,1264365..1264790))
FT                   /locus_tag="ANIA_09444"
FT                   /old_locus_tag="AN9444.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008237"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008237"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008237"
FT                   /db_xref="GOA:Q5AQI6"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQI6"
FT                   /protein_id="CBF85199.1"
FT                   /translation="MCGQYSPFPLVPPKLILLQAACVSTALRASSCDTGDTACLCTTAT
FT                   ALESALGCYSLQCTVKEALCKMTCPDYPRFPLLTSAASTNMTRSTCGLPEESEANLTPA
FT                   LAGSLGMLALIMVGLRIGWRTGTKKTVGWDDGFILLAMPDGAVKYHGLGTNLWTIPFDS
FT                   ITAQLKNQYLLIAEVFYMPAEAFTQLSFLAFYQRIFPPKYKYPIYTLSAISVCFGISNT
FT                   LIMIFQCTPVSFFWNSWTGEVSGTCININTYSWYRAAMQICMDVSIISLPIWPLSRLAL
FT                   STRKKAMVLVMFCTGFLSNNKTRITIVSCLRLQSLIKFSKSPNTSMDNNPAIYWSMVEC
FT                   DVAIICACMPSLPPLLKPIFPRCFATTQQSDPEEERTPQPVRLNQIMKKDEFSVLSSSA
FT                   SGDRLVA"
     atgtgcggtc agtatagtcc cttccctctg gtacctccaa agctcatact cttacaggcg        60
     gcgtgcgttt ctacggcgct gagggctagc agttgcgaca cgggagacac agcctgtctc       120
     tgcacgactg caaccgccct cgagtccgca ttaggatgct acagtctgca gtgtactgtc       180
     aaagaggcac tctgtaagat gacctgcccg gattatcccc gcttccctct gctgaccagc       240
     gcagcctcga cgaacatgac ccggtcgacg tgcggactgc ctgaagagag cgaggcgaac       300
     ctgacgccag cccttgctgg atctctaggc atgctggcac taatcatggt aggactacgc       360
     atcgggtggc ggacgggaac gaagaagaca gttggatggg acgatgggtt tatccttctg       420
     gccatgcctg acggtgcagt gaaataccac ggcctcggaa caaacctgtg gacgatcccg       480
     ttcgacagca taaccgctca gcttaagaat cagtaccttc tcattgcaga ggtcttctac       540
     atgcccgccg aagccttcac gcagctctcc ttcctggcct tttaccagcg catcttcccg       600
     ccaaaatata aatatccaat atacaccttg tctgcaatct cagtatgctt tggcatatca       660
     aacacgctca tcatgatttt tcagtgtacg cccgtctcgt tcttctggaa ctcatggacg       720
     ggtgaagtat cgggcacctg catcaatatc aacacatatt cgtggtaccg cgcggccatg       780
     cagatctgca tggatgtgag catcatcagt cttccgatct ggccgctctc gaggcttgcc       840
     cttagtacaa ggaagaaggc aatggtcctg gtgatgttct gtactgggtt tctatctaat       900
     aacaagacca ggatcacgat cgtcagctgt ctccgtctcc agtctctgat caaattctca       960
     aagtcgccaa ataccagcat ggacaacaat ccggccatct actggagcat ggttgaatgt      1020
     gacgtcgcaa tcatctgcgc ctgcatgcca tctctccccc cactgctgaa gccgatcttt      1080
     ccccgatgct tcgcgacaac ccagcaaagt gatccagagg aagagcgaac tccgcagccg      1140
     gtgcgtctga atcagatcat gaagaaggac gagtttagtg tgctttcaag cagtgcgtcg      1200
     ggggataggc tggtggcatg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page