(data stored in ACNUC16935 zone)

EMBL: BN001307.PE455

BN001307.PE455       Location/Qualifiers
FT   CDS_pept        complement(1267940..1269013)
FT                   /locus_tag="ANIA_01602"
FT                   /old_locus_tag="AN1602.4"
FT                   /product="Putative endo-beta-1,4-glucanasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5BCX8]"
FT                   /note="transcript_id=CADANIAT00008239"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008239"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008239"
FT                   /db_xref="GOA:Q5BCX8"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR005103"
FT                   /db_xref="InterPro:IPR035971"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BCX8"
FT                   /protein_id="CBF85202.1"
FT                   /translation="MKFSSVLALAASAKLVASHATVFAVWINDEDQGLGNTADGYIRTP
FT                   PNNSPVTDVTSTDLTCNVNGDQAAAKTLEVAAGDKITFEWHHNSRDSSDDIIADSHKGP
FT                   VLVYMAPTEAGSAGKNWVKIYEDGYNDGTWAVDTLIANKGKHSVTVPDVPAGNYLFRPE
FT                   IIALHEGNREGGAQLYMECVQFKVTSDGTTQLPEGVSLPGAYTATDEGILFDIYSSFDS
FT                   YPIPGPAVWDGASSGSGSSGSGSSSSAAATSSAEKTATSTTAAATTTAVATSTSSATQV
FT                   QPTSVATFTTSVRPTTSAAPTTSAPTSSAAPTGGTGTGSIQIYQQCGGMNYKGATGCAS
FT                   GLTCKQWNPYYHQCVQA"
     atgaagttct ccagcgtcct cgctctggca gcgagcgcca aactcgtcgc ttcccacgcc        60
     accgtcttcg ctgtctggat caatgacgaa gaccagggcc tcggcaacac cgctgatggc       120
     tacattcgca caccccccaa caacagcccc gtcactgacg tgacctctac tgacctcacc       180
     tgtaacgtca acggcgacca ggccgctgcg aagactctcg aagtcgccgc tggtgacaag       240
     atcacctttg aatggcacca caactcccgc gattcttccg acgacatcat cgccgactcc       300
     cacaagggcc ctgtcctcgt ctacatggcc cccacggagg ccggctctgc gggcaagaac       360
     tgggtcaaga tctacgagga cggatacaac gatggtacat gggctgtcga cactctcatc       420
     gcaaacaagg gcaagcactc ggtgaccgtc cccgacgtgc cggccggtaa ctacctcttc       480
     cgccctgaga tcattgccct gcatgagggc aaccgcgagg gaggcgcgca gctctacatg       540
     gagtgcgtcc agttcaaggt cacctctgac ggtaccactc agctgccgga gggtgtcagt       600
     ctgccgggtg cctacactgc caccgacgag ggaattctct tcgacatcta cagctccttt       660
     gactcctacc ccatccctgg cccggccgtt tgggacggcg cttcgtctgg ctctggctct       720
     tctggctctg gctccagctc cagtgctgcc gctacatcca gcgctgagaa gactgctacc       780
     tccaccactg ccgctgccac aaccaccgct gttgcgacgt ccacctcgtc tgccactcag       840
     gtccaaccca cctccgtggc gaccttcacc accagcgtcc gacccaccac ctccgctgcc       900
     cccactacgt ctgccccgac ttcctctgcc gcccctaccg gcggcaccgg cactggctcc       960
     atccaaatct accagcagtg cggtggaatg aactacaagg gtgccaccgg ctgcgcctct      1020
     ggcctgacct gcaagcagtg gaacccttac taccaccagt gtgtccaggc ttag            1074
//

If you have problems or comments...

PBIL Back to PBIL home page