(data stored in ACNUC16935 zone)

EMBL: BN001307.PE456

BN001307.PE456       Location/Qualifiers
FT   CDS_pept        join(1271179..1271492,1271558..1271651)
FT                   /locus_tag="ANIA_01603"
FT                   /old_locus_tag="AN1603.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008240"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008240"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008240"
FT                   /db_xref="GOA:Q5BCX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX7"
FT                   /protein_id="CBF85204.1"
FT                   /translation="MTKELVSSSAANKALLNMFIAAELRYPVRQCAGARSVRRWEKTCG
FT                   SVGTQLPSALLLYPVAIGILVVCVTLTRIARIREIYKGKGLEIPDDFDSTLTMPPVHFM
FT                   QVSAPDDVDVNELRKVEVPGGLDIEILEFFE"
     atgactaaag aactggtcag ttcttccgcc gcgaataagg ccctgctaaa tatgtttatt        60
     gctgcagagc ttcgatatcc ggttcgccag tgtgccggcg cacgatcagt acggagatgg       120
     gaaaagactt gcggatcggt agggactcag cttccctctg ctctacttct atatcctgtt       180
     gcgataggga ttctggtcgt ttgcgtgacg ctaactagaa tcgccagaat ccgcgagatc       240
     tacaagggaa aagggctcga gatcccagac gattttgact ctacgctgac aatgccgccg       300
     gttcatttca tgcaggtttc cgctccagac gatgtcgacg tcaacgagct caggaaggta       360
     gaggttccgg gagggctgga cattgaaatt ctggaatttt tcgagtag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page