(data stored in ACNUC16935 zone)

EMBL: BN001307.PE458

BN001307.PE458       Location/Qualifiers
FT   CDS_pept        1275781..1276815
FT                   /locus_tag="ANIA_01605"
FT                   /old_locus_tag="AN1605.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008242"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008242"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008242"
FT                   /db_xref="GOA:Q5BCX5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX5"
FT                   /protein_id="CBF85208.1"
FT                   /translation="MERPAFLLPTATSHPTKPNTRIPPILAAGKATSLSPNSTTAAEPP
FT                   FSRIATISRQKLSAEAARGDPDLRRCLGHHRLLARSLYEAKQGMKRYLEEVLESESEDD
FT                   EDIYGEYEFGKGEVLLQEDELVDDEDDDDDDELYDDDLEDEDDDEDIDDECPTVEEEEV
FT                   VAPPASITVSPDPAADSAPAPNPDTSVKDQFSAPVPQSVPASMVPCSNSSTAPGPVWVK
FT                   EKIVGAVRGLVRRRNSTSLSPSPGPSPSTPPPTASPPEAASKSEAQSALAHMAANNASC
FT                   SQIPVYIHIHEHLSKPARRLERSQSQSQLQSRSQGHGRFITMRGRQYAQRLGLKVAAAV
FT                   PVTT"
     atggaacgcc cggcctttct cctcccaacg gcgacctccc atcccacaaa gccaaacacc        60
     cggatcccac ctatccttgc cgccggcaaa gcgactagct taagtcccaa ctctacaacg       120
     gcggccgaac cccccttctc ccgcatcgca accatctcca ggcaaaaact ctccgctgag       180
     gcagccaggg gcgacccaga tctccgtcga tgtctcggcc accaccgtct ccttgcgcgg       240
     tctctatatg aggccaagca gggtatgaag cggtatctcg aggaggtgct ggagagtgaa       300
     agcgaagatg atgaggatat ctatggggag tacgagtttg gaaagggaga ggtcttgctc       360
     caggaggatg agcttgttga cgatgaagac gatgacgatg acgatgaact ctacgatgat       420
     gacctcgagg atgaggatga tgatgaagat attgatgacg aatgtccgac agtggaagaa       480
     gaggaggttg tcgctccccc tgcctctata actgtatccc ccgatcccgc tgcagattca       540
     gctccagcgc caaatccaga tactagtgta aaggatcagt tttcggcgcc ggtaccacaa       600
     tcagtgccag cgtcgatggt gccttgttcc aactccagca ctgccccagg ccctgtctgg       660
     gtgaaggaga agatcgttgg tgcggtgcgc gggctcgtcc gacggcgaaa ctcgacctct       720
     ctctctcctt ccccggggcc ctccccttca acacctccac ctaccgcgtc tcctccggag       780
     gcagcctcca agtcagaggc gcagtcggct ctagctcaca tggccgccaa taacgccagc       840
     tgcagccaga tccccgtcta tatccacatc cacgagcatt tgtccaagcc agccaggaga       900
     ctcgagagga gccagagtca gagccagctg cagagcagat cacagggcca cgggagattt       960
     atcacaatgc gtgggcggca gtatgcgcag cggttggggt tgaaggttgc ggcggcagtg      1020
     ccggtcacga cttga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page