(data stored in ACNUC16935 zone)

EMBL: BN001307.PE46

BN001307.PE46        Location/Qualifiers
FT   CDS_pept        join(123129..123369,123441..123764,123832..123914)
FT                   /locus_tag="ANIA_11158"
FT                   /old_locus_tag="AN11158.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007837"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007837"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007837"
FT                   /db_xref="GOA:C8VKY4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKY4"
FT                   /protein_id="CBF84454.1"
FT                   /translation="MELLPTEILFDIVEHLCNRETKTLSLVSKRVRDVCLPVLFRKINI
FT                   EFSTEGFDLLESLLKSSIRRYIVSFQYIVPKLVKPQIRNYEIFRTEILTPGQYVEACEY
FT                   HDDVDSYEDWDEMEYVSGDQPSYTRMYKTIRRTCARQQEIIEARRDSTLMKLAFQQLSN
FT                   LKELVLVFSQAQGDEDWEEEYQEEYANLSKGFSSPVSNILPTLWWKAHIRTL"
     atggagttgc ttcctaccga aattctcttc gacatcgtgg agcatctttg caaccgggag        60
     accaagacgc tttccctcgt cagtaaacgg gtgagggacg tttgtttacc agtcttattt       120
     cgcaaaatca acattgaatt ttcgaccgag ggttttgact tgttggaaag tcttctgaag       180
     tcgagcattc gtcggtatat cgtctctttc cagtacatcg tcccaaagtt ggtaaaacct       240
     cagatacgga attacgagat ttttagaaca gagatcctta cccctggcca atacgtcgaa       300
     gcatgcgaat accacgacga cgtcgacagt tatgaggatt gggacgaaat ggaatatgtc       360
     tcaggcgatc aaccttctta tacgcggatg tataagacga tacgacgtac ctgtgcgcgg       420
     cagcaagaga tcatagaagc aagaagggat tcgacattga tgaagctcgc atttcaacag       480
     ctttctaact tgaaggaatt ggtgttggta tttagtcaag cacaaggcga cgaggactgg       540
     gaagaggaat accaagagga gtacgcgaac ctatccaagg gattcagctc accagtctcg       600
     aacattttac cgaccctatg gtggaaagcc catatcagga ctctctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page