(data stored in ACNUC16935 zone)

EMBL: BN001307.PE461

BN001307.PE461       Location/Qualifiers
FT   CDS_pept        join(1289044..1289113,1289294..1289754)
FT                   /locus_tag="ANIA_01608"
FT                   /old_locus_tag="AN1608.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008245"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008245"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008245"
FT                   /db_xref="GOA:Q5BCX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX2"
FT                   /protein_id="CBF85213.1"
FT                   /translation="MSQFPTPIRLAQAVGLTGAAYLAGNIFAYSFATIPALESSQNKHG
FT                   APAALLAKQWSELYARGKAQNPPIAAATAAAFAYLAWSVHSGKSAALQVLAPANAAYLY
FT                   SAAAALTVGIVPWTLFAMTKTNDALHERAKEVFVVTEKTADEVKELLAKWKVLNAIRGL
FT                   LPLVGGLVGFLAF"
     atgtcccaat ttccaactcc gatccggctc gcccaggctg ttggcttgac tggagccgca        60
     tatctagccg gaaacatctt cgcctacagc ttcgccacga tcccagccct cgaaagttcc       120
     cagaacaagc acggcgcgcc cgcggccctc ctcgcaaaac aatggagcga gctgtatgcc       180
     cgaggcaaag cgcagaaccc gccgattgca gcggccaccg ccgccgcgtt tgcgtacctt       240
     gcctggtcgg tgcattcggg gaaatcggca gctttgcagg ttcttgcgcc cgcgaatgcg       300
     gcgtatctgt acagcgccgc cgcggcgctg actgtgggta ttgtgccctg gactcttttc       360
     gcaatgacga agacaaatga tgcgctgcat gagagggcaa aggaggtctt tgtcgtcacg       420
     gaaaagacgg ccgatgaagt gaaggagttg ttggccaaat ggaaggtgct taatgcaatc       480
     cgcgggttgt taccgctggt tggcgggttg gttgggtttt tggctttttg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page