(data stored in ACNUC16935 zone)

EMBL: BN001307.PE462

BN001307.PE462       Location/Qualifiers
FT   CDS_pept        join(1290047..1290512,1290707..1290828,1290876..1291153,
FT                   1291379..1291523,1291859..1292208,1292356..1292576,
FT                   1292626..1292738)
FT                   /locus_tag="ANIA_01609"
FT                   /old_locus_tag="AN1609.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008246"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008246"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008246"
FT                   /db_xref="GOA:Q5BCX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX1"
FT                   /protein_id="CBF85215.1"
FT                   /translation="MLVPIRVHIRDPLILLRRRKRLHRVRHLARGYSHRKNQTAAIAPR
FT                   TSGMPTPNPTPRPTPRLLSELLSLPLPPVGVVVGVEVVVTVLVVVTEVEVDELLVLSGE
FT                   RLLTTNSTAGIENVWVELLQSHPPYAVQQNVSVPQAVTRFRNLKPSTSPRLTLRWVAAL
FT                   RASNARYILVAVAVVALGYHFGADRARSAGNGTIFSRDECEDGKSVDRETLWSTGDCLK
FT                   NEIKNPKKSRSEAKGRLSVGSLDEDLRPKDARKLKFWQDAVRNQSPGNRNIASWRLQAS
FT                   PNRTSDNLFSAEVTEGTPYNYTAPCQGLKATLVLHRASLNSATQGLHLVPDNAESCSGY
FT                   GKVEQWDVDAYSCQGQAYLDTSIANRTTHLKLASSDISSAMRIHHKQQYPLQLYAAGSA
FT                   SQTPTSSLLAIKSKILLNKRSKVHRSGRKSSRHWIHRSAYSNGQRCSSSHHFGLRRVCL
FT                   FATHGDPDMIMTAAEGRLPTARVVAAIYLLFSTDHVPAPGGEIVICNTFPSYSLVIFRR
FT                   MARRTGYNGLAFKDAREKKESRSKAWVMELLKGQSARGDWTKSLRSR"
     atgcttgttc ccattcgcgt acacatccgc gacccgctta tcctgctgcg tcggcgcaaa        60
     cgcctccatc gagttcggca tctcgcccgg ggctacagcc accggaagaa ccagaccgct       120
     gcgatcgcac cgagaaccag tggtatgccg acgcctaacc cgactccgag accgacaccg       180
     aggttgctgt ctgagctgtt gtcgctgccg ctgccgcccg ttggtgttgt ggtcggtgtt       240
     gaggtcgtcg taactgtact tgtagtcgtc actgaggtcg aagtcgatga gctactcgtg       300
     ctctctggcg agagactgct gactacaaac tcgacggccg gaatcgagaa tgtctgggtt       360
     gagttattgc agtcacatcc tccgtacgcg gtgcagcaga acgtctcggt gccgcaggct       420
     gtgacgcgtt tccggaatct gaaaccatcc acatcgcccc ggttaacatt gcgctgggtt       480
     gccgccctaa gagcaagtaa tgcgcgttac atcctcgttg ccgtcgcggt cgtagcactt       540
     ggctaccatt ttggcgccga tcgggcgagg tcggcgggta atgggacgat cttctcccgg       600
     gatgaatgcg aggatggaaa aagtgtggat cgcgagacgc tgtggtccac gggcgattgc       660
     ctcaagaacg aaattaagaa tccaaagaag agccgatccg aggcgaaagg gaggctgagc       720
     gtgggatcgc tagacgaaga cctaaggcca aaagatgcca ggaaattgaa gttttggcaa       780
     gatgcggtaa ggaaccaaag ccctggtaat cgcaatattg cttcctggcg cttacaggct       840
     agtcccaacc gcacctctga taaccttttt tctgcagaag taaccgaagg tacaccgtat       900
     aattatactg cgccttgtca ggggctcaaa gccacgctag ttctgcaccg ggccagtctt       960
     aactcagcca ctcagggtct gcacctcgtg cccgataatg cagaaagttg tagtggctac      1020
     ggcaaggtcg aacagtggga tgtcgatgct tatagttgcc agggacaagc ttacctagat      1080
     acatccattg caaatcgcac cacccacttg aagcttgctt cttccgatat ttcatccgcc      1140
     atgcggattc atcataaaca gcagtatcct cttcagcttt acgcggcagg atccgcatcg      1200
     caaacaccga ccagtagcct gctcgcgatt aagagtaaga tcttgctaaa taaaaggtcc      1260
     aaggttcacc gatccggaag aaagtcctct cgccattgga ttcatagaag cgcgtatagc      1320
     aatggtcaga ggtgctcgtc ctcccatcat ttcggtttaa gacgcgtttg tctcttcgca      1380
     acacacggcg atccagacat gataatgacc gctgccgagg gcagacttcc cacggctcgc      1440
     gtagtagccg caatttactt gcttttttcc accgatcatg tgccagcgcc tggaggtgag      1500
     attgttattt gcaacacttt cccctcatat tctcttgtta tctttcggcg aatggcccgg      1560
     cgaactgggt acaatggtct ggcattcaaa gatgcgcgag agaaaaagga aagcagaagc      1620
     aaggcctggg ttatggaatt actgaaaggt cagagcgcta gaggtgactg gaccaagagc      1680
     ttgcgcagtc ggtag                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page