(data stored in ACNUC16935 zone)

EMBL: BN001307.PE463

BN001307.PE463       Location/Qualifiers
FT   CDS_pept        join(1295333..1295370,1295449..1296442)
FT                   /locus_tag="ANIA_01610"
FT                   /old_locus_tag="AN1610.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008247"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008247"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008247"
FT                   /db_xref="GOA:C8VNA7"
FT                   /db_xref="UniProtKB/TrEMBL:C8VNA7"
FT                   /protein_id="CBF85217.1"
FT                   /translation="MSRSKDSLDSTSSRISKSQLFPLAHPPPKSKSAPNKSPRLRLSSR
FT                   LVLQIQQSSQSRAIPILELYQPSTFGKSIALPDGSRKVHGRDMYVTQSEMYTHLKRPRK
FT                   RDAVDGYGTGYGHGYGNAYGHTTKPRSGSGGSRSVSGSAYSSAASSRPKSRSSGASSGD
FT                   EGQGECKAKFRARRKSGNDADGEQDDVVAMIHTSPKSTAADAQLFFPQNNQTWETTSSR
FT                   PGYYRFQSDGSSVVFEWEKRPPSRSHPSSAAENDDGERFVLSVSVSEPTSSHTKRPWLA
FT                   QLSKRGVHVGGLEPWRDEPGLRALIDGVGDGAGAGGSGAGAGLYTLILTMGVWVAKGEG
FT                   WVN"
     atgagcagat caaaagacag ccttgactcg acctcgagtc gaatctcgaa gagccagctc        60
     ttcccgctcg cccaccctcc gccgaaatcc aagtccgcac cgaacaagtc gccgcgtctc       120
     cgtctttcct cacggctggt cttgcagatc cagcaatcgt cccaatcccg tgcgatcccg       180
     attctggagc tctaccagcc gtccacattt gggaaatcga ttgcgctgcc agatgggagc       240
     aggaaggtgc atgggcggga tatgtatgtg actcagagcg agatgtatac gcacctcaaa       300
     cggccaagaa agagagatgc ggtggatggg tacggaactg ggtatggaca tgggtatgga       360
     aatgcgtatg ggcatacgac gaaaccgcgc tcggggtctg gagggtcacg ctcagtgtct       420
     gggtcagcgt atagctcggc agccagcagt cgtcccaagt cgagatccag cggggccagt       480
     tcaggcgatg agggtcaggg cgagtgcaag gccaagttca gggctagacg gaagagcgga       540
     aacgatgccg acggcgaaca agacgatgtc gtcgcgatga tacatacctc acccaagtca       600
     acggccgcag acgcacaact cttctttccc cagaacaacc agacctggga aacgacctcg       660
     tccaggcccg ggtattatcg attccagagc gatgggagct cggtagtatt cgaatgggag       720
     aaacgccctc cctcgcgctc gcatccttct agtgccgcgg agaatgatga cggtgagagg       780
     tttgtcctca gtgtgagtgt ttcagaaccg acgtcatcgc acaccaagag gccttggctg       840
     gcgcaactgt ctaagcgagg cgtccatgtg ggtggactag aaccgtggcg agacgagccg       900
     gggcttcggg cgttgatcga cggcgttggc gacggcgccg gcgctggggg ctcgggcgca       960
     ggcgcggggc tgtacacgct cattctgacg atgggcgtgt gggttgcgaa gggtgaggga      1020
     tgggtcaact ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page