(data stored in ACNUC16935 zone)

EMBL: BN001307.PE464

BN001307.PE464       Location/Qualifiers
FT   CDS_pept        complement(1296544..1298433)
FT                   /locus_tag="ANIA_01611"
FT                   /old_locus_tag="AN1611.4"
FT                   /product="flavin-binding monooxygenase-like protein
FT                   (AFU_orthologue; AFUA_4G09220)"
FT                   /note="transcript_id=CADANIAT00008248"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008248"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008248"
FT                   /db_xref="GOA:Q5BCW9"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW9"
FT                   /protein_id="CBF85220.1"
FT                   /translation="MSAAKIEPGSFNIPVGTFPATCKTPQESINAHALATSILSRLNTA
FT                   LSTSKISDIAALFLEQGSFWRDHLCLSWNFHTAKGREGIASLLSQVEKEKLNHLKLEID
FT                   ISTPFRSPQISAIDAFGEVIGVQFFITVSTAIGSGRGVVRLAEGDEGEWYIYTLYTVLQ
FT                   ELTGHEEQVSSRRPFGAVHGEISGRPRLNWQDRRKAETNLDENKEPAVLIVGAGQAGLS
FT                   VAARLRMLGVDALIIDQEDRVGDNWRRRYHQLVLHDPVWFDHMPYLPFPSNWPVFTPKD
FT                   KLAEFFECYVKLLELNVWTRTTVKEAKWHADGKEWSVEVIRRTDSGEVKRVLHPRHIIQ
FT                   ATGHSGEKNLPEFKGIESFKGSRICHSSEFEGATDADPRKGQQKAVVVGSCNSAHDIAQ
FT                   DYYEKGYDVTMVQRSSTCVISSDAIVNIGLKGLYEENGPPVHDSDVFLYSIPSEQFKAQ
FT                   QVRITAVQNEHDKVLLEGLEKAGFKVDKGPDDAGLLMKYWQRGGGYTIEVGAGRLIADG
FT                   KIKVKQGEEIAEILPQGLRFADGSELEADEIVFATGYKNMREQTRLIFGDMVANSVNSV
FT                   WGLDSEGEMRTIWRKTGHPGFWFMGGNLAMCRYYSLLLALQILGIERGLNEVQ"
     atgtcagccg ccaagatcga accgggctcg ttcaacatcc cagtgggaac attccctgca        60
     acctgcaaga ccccccaaga atccataaac gcacacgctc tcgcaacatc gatcctttcc       120
     aggctcaata ccgccctatc gacctccaag atttcagaca tagcggccct cttcctcgag       180
     cagggcagtt tctggcgcga ccacctctgt ctctcatgga acttccacac tgcgaaagga       240
     agggaaggga tcgcatctct gctcagccaa gtcgagaagg agaaattgaa ccatctgaaa       300
     cttgagatcg atatctcgac tccattccgg tcgccccaga tcagcgccat cgatgccttc       360
     ggcgaggtaa tcggcgtgca gttcttcatc accgtctcga cggcgattgg atctggtcgc       420
     ggggtggttc gcctggccga gggtgacgag ggagagtggt atatctacac gctctatacc       480
     gtcctccagg aactgacagg gcacgaagag caagtcagct cgcgacggcc ttttggagca       540
     gtccacggag agattagtgg tagacctagg cttaactggc aagaccgtcg caaggcggaa       600
     accaaccttg acgagaacaa agagccagct gtcctcattg tgggcgcagg ccaagctgga       660
     ctctccgtcg cagcgcggct gaggatgctc ggtgttgatg cgctgatcat cgaccaggaa       720
     gaccgggtag gtgataactg gcgaagacgg taccaccagc tcgtcctgca tgatcccgtg       780
     tggttcgatc acatgccgta ccttccattc ccaagcaact ggcctgtttt cacgccaaag       840
     gataagctcg cggagttctt cgagtgctat gtgaagctgc tggagctgaa tgtctggacg       900
     cggacgacgg tcaaggaggc aaagtggcat gctgacggga aagagtggtc tgtagaggtt       960
     atacggagaa cggattcggg cgaggtaaag agggttctcc atccgcgaca tataatccag      1020
     gcaactggac attcaggcga gaagaacctg cctgaattca aaggtatcga gagcttcaaa      1080
     ggcagccgca tctgccatag ttccgagttc gagggcgcga cagacgcaga cccacgcaag      1140
     ggtcagcaga aggcggttgt cgtaggatcc tgcaattcag cccacgatat cgcgcaagac      1200
     tactacgaga aaggctacga cgtcaccatg gtgcagcgct cgtccacctg cgtcatctca      1260
     tcagacgcga ttgtgaatat cggattgaag ggtctctatg aggagaacgg gcccccggtg      1320
     cacgactctg acgtttttct ctacagtatc cccagcgagc aattcaaagc acagcaggtc      1380
     agaattacgg cggtgcagaa cgagcatgac aaagtgcttc ttgaaggtct tgagaaggct      1440
     ggattcaaag tcgacaaggg ccctgatgac gccgggctgc ttatgaagta ctggcagcgg      1500
     ggcggaggat acacaatcga agttggcgct ggaagactca tagcggacgg gaagatcaaa      1560
     gtcaagcagg gagaagagat cgcagagatc ctcccgcagg gactcaggtt cgctgacggc      1620
     tctgagttgg aagcagatga gattgtcttt gcaaccgggt acaagaatat gcgcgagcag      1680
     accagactga tctttggtga tatggttgcc aacagcgtaa acagtgtctg ggggctcgat      1740
     agcgaaggcg agatgcgcac catctggcgc aagaccggcc accccggttt ctggtttatg      1800
     ggcgggaatc tggcgatgtg tcggtactac tcgcttttat tggcgttgca gatactaggg      1860
     attgaaaggg gcctgaacga ggtccagtaa                                       1890
//

If you have problems or comments...

PBIL Back to PBIL home page