(data stored in ACNUC16935 zone)

EMBL: BN001307.PE466

BN001307.PE466       Location/Qualifiers
FT   CDS_pept        complement(join(1303118..1303161,1303237..1303413,
FT                   1303444..1303812,1303908..1304041,1304105..1304391))
FT                   /locus_tag="ANIA_01613"
FT                   /old_locus_tag="AN1613.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008250"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008250"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW7"
FT                   /protein_id="CBF85223.1"
FT                   /translation="MIPYSHEHLQDRPFPASARRESTATVSSTPSTATSSRSSVSGSLC
FT                   FVSEPPFSPSLSPSLFPSPSTSASVSLASRPREGSLNDEVARLPLNPAVTVSFVRSSRL
FT                   FKLRYTFINIRKDFAGALKCLELGGAVGQQTAFLHSFNTTRLPVPHLEHPITSSEPYTP
FT                   SSLRISFLDEQTVQTGATVFATQLSYTFESWLDCLQFQELILASRIVFIAGIAEAKSKG
FT                   RGEECISQNLRILRQDHTGKLVMLFFANSQRKERKRYVSIPLNHIHYGLRADYSRWHLV
FT                   SCIESVMPGKNSRRPVVLQLQPNFDHLAQMRTLQISFLDSDDKKAFCEFLAANNR"
     atgatcccat attctcacga acatctccaa gaccggccgt ttccagcctc tgccagacgc        60
     gaaagcactg cgaccgtttc ttccaccccc tcgaccgcga cctcgtcccg ctcgtccgtc       120
     tccggctccc tctgcttcgt ctctgaaccg cccttctcgc cctctctaag cccgtctttg       180
     tttccttcgc catcgacctc agcgtctgtg tcgctcgcat cccggccgcg agagggctcc       240
     ctcaatgacg aggtcgcacg attaccgctc aaccccgcgg tgacggtgtc cttcgtcagg       300
     agcagcagac tcttcaagct ccggtataca ttcatcaata tccggaagga tttcgccggc       360
     gctttgaaat gcctcgaact aggcggcgca gttgggcagc agactgcctt tctacatagc       420
     tttaatacaa cccgtcttcc cgtaccccac ctcgaacatc cgatcacctc ctcagagccc       480
     tacaccccgt cctcactccg catctccttc ctggacgagc agaccgtcca aaccggcgcg       540
     accgtctttg caacccaact ctcctacaca ttcgaatcct ggctggactg tctacagttt       600
     caagaactca ttctcgcctc gcgaatcgtc tttatcgcag gtatcgccga ggcgaaatcc       660
     aaaggtcgtg gcgaggagtg tatatcgcag aatctgcgga tcctaaggca ggaccatacg       720
     ggaaaactgg tgatgctctt ctttgccaat tcgcagagga aagagaggaa gcgatacgtt       780
     tccatcccac tgaatcacat tcattatgga ctgcgcgctg actacagtcg atggcaccta       840
     gtgagctgta tagagagcgt catgccaggc aaaaactcac ggcgaccggt ggtgctccag       900
     ctccagccaa actttgacca tctggcacag atgaggacgc tgcagatctc gtttctggat       960
     agcgacgata aaaaagcgtt ctgtgaattt ctcgcagcca ataatcgatg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page