(data stored in ACNUC16935 zone)

EMBL: BN001307.PE468

BN001307.PE468       Location/Qualifiers
FT   CDS_pept        complement(join(1309778..1309830,1309891..1310009,
FT                   1310177..1310197,1310253..1310481,1310876..1310923,
FT                   1311189..1311285,1311367..1311421,1311481..1312769))
FT                   /locus_tag="ANIA_01615"
FT                   /old_locus_tag="AN1615.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008252"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008252"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008252"
FT                   /db_xref="GOA:Q5BCW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW5"
FT                   /protein_id="CBF85226.1"
FT                   /translation="MSSTLSTPSLSQFPTPNQTPRLPTPPNSPEETHPHIMSAEENEIL
FT                   AQESTRLTESGDDFAPTITSLLNEYTDRMKQIQRRRLAEQKGEHEILYAKLRRQKDSAL
FT                   SGLKQAQDLTTRYKQELDAKVIEEEQLTEKMKTLEKLLAETATQLSDTTKAYAEKEEIW
FT                   NSVMGPLARLENDNNEIREQLGEIKQQLEGTNASIAEERAISDRNLSELASVRDKLAEE
FT                   KVQRAAVERRLNEQDDRVRLLSNRIIYLKASKLQLRSELNQARREAEQVNRLRSANEEL
FT                   GARCETLTRDVSDLRDVRHHHEDEIRRMKQQQDTMTGAIHHLTSEVQVEQKRSEQLQSS
FT                   VSDLEQKRDGLNNQLQHLQGEYNDLTGALANAHEAARRAEICMQWVVIAHRARCRSLKA
FT                   EVAELKSSRLPKVEAKRSLANIRRGNSPARLGVVERPPVTIRKPRWKNQTVNSITTSAA
FT                   AYLFWLCKTTGLRSALYALTTSCNHEEIKARCQPGMIQIYQLYPNSKIGATQLKKRLAN
FT                   VGLPKDHDYSRPTSEVTDTKVLVEVHEDRAQEQAQQPAAIPSQFQPEHNNICKATGRIL
FT                   TVRHPRRIQERVAQKDDLGIPSAVLPAHGPSQSCSLGIRVGRRPSYYLRTFGQKPDRGV
FT                   L"
     atgtcatcca cactgtctac tccgtcattg tctcagtttc cgacgccgaa ccaaaccccc        60
     aggcttccca ctcccccgaa ctcgccagag gaaacgcatc cccatatcat gagtgcggaa       120
     gagaacgaaa ttcttgcgca agagtctacg cggctgactg aatctggcga tgatttcgct       180
     ccaacgatca cctcactcct gaacgaatat accgacagaa tgaagcaaat acagaggcgg       240
     agactagctg aacagaaagg agaacatgag atactttatg caaaacttag aagacaaaaa       300
     gactcagcgc tgtctggtct gaagcaggcg caagatctta ccaccagata caagcaggaa       360
     cttgacgcaa aagtcattga agaggagcag ctcactgaga agatgaaaac cctagagaag       420
     ctgcttgctg agacagccac gcaactttca gacactacga aggcgtatgc tgagaaagag       480
     gaaatatgga attctgtcat gggtcccctg gcgaggttag agaacgacaa caacgaaatc       540
     cgggagcagc tgggagaaat aaaacagcag ctagagggga ccaatgcttc aattgccgag       600
     gaaagagcta tcagtgacag aaacctctca gaactcgctt ctgtgagaga caaactagct       660
     gaggaaaaag tccagcgagc cgccgtcgaa cgcaggttga acgagcaaga cgatagagtg       720
     agactgctca gcaacagaat tatatacttg aaggcgagca aattgcagct tcgctccgag       780
     ttgaaccagg ctagaagaga agctgaacaa gtgaatcggc tgcgttccgc aaacgaagag       840
     ctcggagcca ggtgtgaaac actgacaaga gacgtttccg acctcagaga cgtccgacat       900
     caccacgaag acgaaatcag gagaatgaag cagcagcagg atacaatgac tggcgcgatc       960
     caccacttga ccagcgaggt gcaagtggag caaaaacgaa gtgagcaact gcagtcaagt      1020
     gtatcggatc tggaacagaa acgcgacggg ctcaataatc agcttcaaca tctccaggga      1080
     gagtataatg atctcacagg tgccctcgca aacgcccatg aagcggctcg acgtgcggag      1140
     atttgcatgc agtgggtggt cattgctcat cgagctcgtt gtcgctcact gaaggccgaa      1200
     gtagcagagc tcaagtcaag tcggctgccc aaggttgaag caaagcggag cttagcaaac      1260
     atcagacgtg gaaactctcc ggccaggttg ggcgtggttg agaggcctcc agtgaccatt      1320
     cgcaaacctc gttggaaaaa tcagactgtt aactcaatca ctaccagtgc cgctgcctat      1380
     ctgttttggc tttgcaaaac cactggctta cgcagtgcct tatacgcatt gacaactagt      1440
     tgtaatcacg aggagatcaa ggctaggtgc cagccaggga tgatccagat ataccagctg      1500
     tatcctaaca gcaagatagg agcaacccag ctgaaaaaac ggctcgccaa tgttggattg      1560
     ccaaaagacc acgattattc tcggcctact tctgaagtca cagatactaa agtattagta      1620
     gaagtccatg aggatcgggc acaagagcaa gcccaacagc ctgccgctat tccgtcccaa      1680
     ttccagccgg agcacaacaa catctgcaaa gctacaggcc gaattttgac cgtcaggcat      1740
     ccaagaagaa tccaagaaag agtagcacaa aaggacgact taggaatccc gtctgcagtt      1800
     ctccccgctc acggtccatc acagtcttgc agtctgggta ttcgcgtcgg tcgcagaccc      1860
     agctactatc tccgtacatt tgggcagaag ccggatcgcg gtgtactatg a               1911
//

If you have problems or comments...

PBIL Back to PBIL home page