(data stored in ACNUC16935 zone)

EMBL: BN001307.PE469

BN001307.PE469       Location/Qualifiers
FT   CDS_pept        join(1315711..1315835,1315913..1315999,1316056..1316136,
FT                   1316202..1317123)
FT                   /locus_tag="ANIA_01616"
FT                   /old_locus_tag="AN1616.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008253"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008253"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008253"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW4"
FT                   /protein_id="CBF85228.1"
FT                   /translation="MSMFPPAPKPPTLLGYHRVLSPSAGVKVSPLCLGAMNFGDAWKEY
FT                   MGECNKEQTFALLDAFYEAGGNFIDTANNYQQEESEKWIGEWLKKRGNRDQMVIATKYT
FT                   TGFRTSHRATEPLQSNFVGNSFKSMRVSVDNSLRKLQTDYIDILYLHWWDFTTSVEEVM
FT                   HGLNSLVTAGKVLYLGVSDTPAWVVVKANDYARAHGLKPFSVYQGKWNAAYRDMEREIV
FT                   PMCRDQGMGIAPWAPLGGGKFKSAEARKAASSGGSNRGAEMSESDIRISDALEKIAERK
FT                   KTTLHAIVSHPCQYPYLYSITDQCPCQALAYVMHKTPNVFPIVGQRKIEHLKANIEALS
FT                   ISLSDADMDEIDGATEFDVGFPMSFIFREFTGRNTAADVWLTKASALIDAPPQPGPVRH
FT                   REAER"
     atgtccatgt tccctccagc tccgaaaccg ccaaccctcc ttggctacca ccgagtcctc        60
     tccccctcgg ctggcgtcaa agtgtcgccg ctgtgtctgg gggccatgaa cttcggtgat       120
     gcctggaaag aatacatggg tgaatgtaac aaggagcaga cttttgctct ccttgatgcc       180
     ttttacgaag ctggcgggaa ctttatcgac actgcaaaca actaccagca agaagaaagt       240
     gagaagtgga tcggcgagtg gctgaagaag cgcggtaacc gtgatcagat ggtcattgca       300
     acaaaatata caaccgggtt ccgcacctct caccgagcga ccgagcctct tcaatccaac       360
     ttcgttggca acagcttcaa gtccatgcgc gtctccgtcg acaactccct ccgcaagctt       420
     cagacagact acatcgacat cctctacctg cactggtggg actttacaac gagcgtggaa       480
     gaagtcatgc acgggctcaa tagcctggta actgccggaa aagtgctcta ccttggtgtg       540
     agtgatacac ccgcatgggt cgtcgtcaaa gcgaacgact atgcgcgcgc gcacggcctc       600
     aagcctttct cggtctacca ggggaagtgg aacgccgcct accgcgatat ggagagagag       660
     attgtcccca tgtgccgcga tcaggggatg gggattgcgc cgtgggcgcc gcttggtggc       720
     ggcaagttta agagcgcaga ggcccggaag gctgcgagca gcggtgggag taaccgcggg       780
     gcggagatga gcgagagcga tatcaggatc tcagacgcgc tggaaaagat tgcggagagg       840
     aagaagacca ctttgcatgc tatcgtgagc cacccttgcc agtacccata tctgtattcg       900
     atcactgacc agtgcccatg ccaggccctc gcatatgtca tgcacaaaac gcccaacgtc       960
     ttccccatcg ttggccagcg caagatcgag cacttgaagg ccaacatcga ggcgttgagc      1020
     atttcacttt ctgacgctga catggatgag attgacggcg ccactgagtt tgatgtcgga      1080
     ttcccgatga gtttcatctt cagggagttc acaggcagga atacggctgc ggatgtttgg      1140
     cttacgaagg cttctgcgct tattgatgcg ccgccacagc cagggcctgt gaggcaccgc      1200
     gaggctgaga gatag                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page